CPEB1 (NM_001079534) Human Recombinant Protein
CAT#: TP313337
Recombinant protein of human cytoplasmic polyadenylation element binding protein 1 (CPEB1), transcript variant 4, 20 µg
View other "CPEB1" proteins (12)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC213337 protein sequence
Red=Cloning site Green=Tags(s) MLFPTSAQESSRGLPDANDLCLGLQSLSLTGWDRPWSTQDSDSSAQSSTHSVLSMLHNPLGNVLGKPPLS FLPLDPLGSDLVDKFPAPSVRGSRLDTRPILDSRSSSPSDSDTSGFSSGSDHLSDLISSLRISPPLPFLS LSGGGPRDPLKMGVGSRMDQEQAALAAVTPSPTSASKRWPGASVWPSWDLLEAPKDPFSIEREARLHRQA AAVNEATCTWSGQLPPRNYKNPIYSCKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKG YVYLVFELEKSVRSLLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQRLDPSR TVFVGALHGMLNAEALAAILNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVSAAFVEIKTTKF TKKVQIDPYLEDSLCHICSSQPGPFFCRDQVCFKYFCRSCWHWRHSMEGLRHHSPLMRNQKNRDSS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 53.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001073002 |
| Locus ID | 64506 |
| UniProt ID | Q9BZB8 |
| Refseq Size | 3095 |
| Cytogenetics | 15q25.2 |
| Refseq ORF | 1458 |
| Synonyms | CPE-BP1; CPEB; CPEB-1; h-CPEB; hCPEB-1 |
| Summary | This gene encodes a member of the cytoplasmic polyadenylation element binding protein family. This highly conserved protein binds to a specific RNA sequence, called the cytoplasmic polyadenylation element, found in the 3' untranslated region of some mRNAs. The encoded protein functions in both the cytoplasm and the nucleus. It is involved in the regulation of mRNA translation, as well as processing of the 3' untranslated region, and may play a role in cell proliferation and tumorigenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014] |
| Protein Pathways | Dorso-ventral axis formation, Oocyte meiosis, Progesterone-mediated oocyte maturation |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410792 | CPEB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421521 | CPEB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC421522 | CPEB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC421523 | CPEB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410792 | Transient overexpression lysate of cytoplasmic polyadenylation element binding protein 1 (CPEB1), transcript variant 1 |
CNY 3080.00 |
|
| LY421521 | Transient overexpression lysate of cytoplasmic polyadenylation element binding protein 1 (CPEB1), transcript variant 2 |
CNY 4840.00 |
|
| LY421522 | Transient overexpression lysate of cytoplasmic polyadenylation element binding protein 1 (CPEB1), transcript variant 4 |
CNY 4840.00 |
|
| LY421523 | Transient overexpression lysate of cytoplasmic polyadenylation element binding protein 1 (CPEB1), transcript variant 3 |
CNY 3080.00 |
|
| PH306406 | CPEB1 MS Standard C13 and N15-labeled recombinant protein (NP_001073003) |
CNY 19520.00 |
|
| PH313337 | CPEB1 MS Standard C13 and N15-labeled recombinant protein (NP_001073002) |
CNY 19520.00 |
|
| TP306406 | Recombinant protein of human cytoplasmic polyadenylation element binding protein 1 (CPEB1), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP761390 | Purified recombinant protein of Human cytoplasmic polyadenylation element binding protein 1 (CPEB1), transcript variant 1, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
