LST1 (NM_205839) Human Recombinant Protein
CAT#: TP313326
Recombinant protein of human leukocyte specific transcript 1 (LST1), transcript variant 4, 20 µg
View other "LST1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC213326 representing NM_205839
Red=Cloning site Green=Tags(s) MLSRNDDICIYGGLGLGGLLLLAVVLLSACLCWLHRRVKRLERSWAQGSSEQELHYASLQRLPVPSSEGP DLRGRDKRGTKEDPRADYACIAENKPT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 10.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_995311 |
| Locus ID | 7940 |
| UniProt ID | O00453 |
| Refseq Size | 769 |
| Cytogenetics | 6p21.33 |
| Refseq ORF | 291 |
| Synonyms | B144; D6S49E; LST-1 |
| Summary | The protein encoded by this gene is a membrane protein that can inhibit the proliferation of lymphocytes. Expression of this gene is enhanced by lipopolysaccharide, interferon-gamma, and bacteria. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC432498 | LST1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY432498 | Transient overexpression lysate of leukocyte specific transcript 1 (LST1), transcript variant 6 |
CNY 3080.00 |
|
| PH313326 | LST1 MS Standard C13 and N15-labeled recombinant protein (NP_995311) |
CNY 19520.00 |
