LST1 (NM_205839) Human Mass Spec Standard
CAT#: PH313326
LST1 MS Standard C13 and N15-labeled recombinant protein (NP_995311)
View other "LST1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | LST1 MS Standard C13 and N15-labeled recombinant protein (NP_995311) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC213326 |
| Predicted MW | 10.8 kDa |
| Protein Sequence |
>RC213326 representing NM_205839
Red=Cloning site Green=Tags(s) MLSRNDDICIYGGLGLGGLLLLAVVLLSACLCWLHRRVKRLERSWAQGSSEQELHYASLQRLPVPSSEGP DLRGRDKRGTKEDPRADYACIAENKPT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_995311 |
| RefSeq Size | 769 |
| RefSeq ORF | 291 |
| Synonyms | B144; D6S49E; LST-1 |
| Locus ID | 7940 |
| Cytogenetics | 6p21.33 |
| Summary | The protein encoded by this gene is a membrane protein that can inhibit the proliferation of lymphocytes. Expression of this gene is enhanced by lipopolysaccharide, interferon-gamma, and bacteria. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC432498 | LST1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY432498 | Transient overexpression lysate of leukocyte specific transcript 1 (LST1), transcript variant 6 |
CNY 3080.00 |
|
| TP313326 | Recombinant protein of human leukocyte specific transcript 1 (LST1), transcript variant 4, 20 µg |
CNY 2900.00 |
