Estrogen Receptor 1 (ESR1) (NM_000125) Human Recombinant Protein
CAT#: TP313277
Recombinant protein of human estrogen receptor 1 (ESR1), transcript variant 1, 20 µg
View other "Estrogen Receptor 1" proteins (14)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 6 publications. |
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>Peptide sequence encoded by RC213277
Blue=ORF Red=Cloning site Green=Tag(s) MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAAN AQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSG YTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKA FFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEG RGEVGSAGDMRAANLWPSPLMIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGL LTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQ GKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKIT DTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAP TSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV myc-FLAG tag Recombinant protein using RC213277 also available, TP313277 |
| Tag | C-Myc/DDK |
| Predicted MW | 66 kDa |
| Concentration | >0.1 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | Binding assay (PMID: 28842010) |
| Reference Data | |
| RefSeq | NP_000116 |
| Locus ID | 2099 |
| UniProt ID | P03372 |
| Refseq Size | 6456 |
| Cytogenetics | 6q25.1-q25.2 |
| Refseq ORF | 1785 |
| Synonyms | ER; Era; ESR; ESRA; ESTRR; NR3A1 |
| Summary | This gene encodes an estrogen receptor and ligand-activated transcription factor. The canonical protein contains an N-terminal ligand-independent transactivation domain, a central DNA binding domain, a hinge domain, and a C-terminal ligand-dependent transactivation domain. The protein localizes to the nucleus where it may form either a homodimer or a heterodimer with estrogen receptor 2. The protein encoded by this gene regulates the transcription of many estrogen-inducible genes that play a role in growth, metabolism, sexual development, gestation, and other reproductive functions and is expressed in many non-reproductive tissues. The receptor encoded by this gene plays a key role in breast cancer, endometrial cancer, and osteoporosis. This gene is reported to have dozens of transcript variants due to the use of alternate promoters and alternative splicing, however, the full-length nature of many of these variants remain uncertain. [provided by RefSeq, Jul 2020] |
| Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Citations (6)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Studying paraben-induced estrogen receptor- and steroid hormone-related endocrine disruption effects via multi-level approaches.
,null,
The Science of the total environment
,PubMed ID 36702264
[ESR1]
|
|
Butyl octyl phthalate interacts with estrogen receptor α in MCF‑7 breast cancer cells to promote cancer development
,Böckers, M;Paul, N;Efferth, T;,
World Academy of Sciences Journal
[ESR1]
|
|
Bisphenolic compounds alter gene expression in MCF-7 cells through interaction with estrogen receptor α
,Böckers, M;Paul, NW;Efferth, T;,
Toxicol. Appl. Pharmacol.
,PubMed ID 32387340
[ESR1]
|
|
Indeno[1,2,3-cd]pyrene and picene mediate actions via estrogen receptor α signaling pathway in in vitro cell systems, altering gene expression
,Böckers, M;Paul, NW;Efferth, T;,
Toxicol. Appl. Pharmacol.
,PubMed ID 32251684
[ESR1]
|
|
Organophosphate ester tri-o-cresyl phosphate interacts with estrogen receptor α in MCF-7 breast cancer cells promoting cancer growth
,Böckers, M;Paul, NW;Efferth, T;,
Toxicol. Appl. Pharmacol.
,PubMed ID 32234386
[ESR1]
|
|
A Novel High Throughput Screening Assay for Binding Affinities of Perfluoroalkyl Iodide for Estrogen Receptor Alpha and Beta Isoforms
,Song, W;Zhao, L;Sun, Z;Yang, X;Zhou, Q;Jiang, G;,
Talanta
,PubMed ID 28842010
[ESR1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400046 | ESR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC426553 | ESR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426554 | ESR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426555 | ESR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400046 | Transient overexpression lysate of estrogen receptor 1 (ESR1), transcript variant 1 |
CNY 4840.00 |
|
| LY426553 | Transient overexpression lysate of estrogen receptor 1 (ESR1), transcript variant 2 |
CNY 3080.00 |
|
| LY426554 | Transient overexpression lysate of estrogen receptor 1 (ESR1), transcript variant 3 |
CNY 3080.00 |
|
| LY426555 | Transient overexpression lysate of estrogen receptor 1 (ESR1), transcript variant 4 |
CNY 3080.00 |
|
| PH313277 | ESR1 MS Standard C13 and N15-labeled recombinant protein (NP_000116) |
CNY 19520.00 |
|
| PH326003 | ESR1 MS Standard C13 and N15-labeled recombinant protein (NP_001116212) |
CNY 14250.00 |
|
| PH326004 | ESR1 MS Standard C13 and N15-labeled recombinant protein (NP_001116213) |
CNY 14250.00 |
|
| TP326003 | Purified recombinant protein of Homo sapiens estrogen receptor 1 (ESR1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP326004 | Purified recombinant protein of Homo sapiens estrogen receptor 1 (ESR1), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP720514 | Recombinant protein of human estrogen receptor 1 (ESR1), transcript variant 1 |
CNY 3140.00 |
其它Estrogen Receptor 1产品


