TPPP3 (NM_015964) Human Recombinant Protein
CAT#: TP312586
Recombinant protein of human tubulin polymerization-promoting protein family member 3 (TPPP3), 20 µg
View other "TPPP3" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212586 representing NM_015964
Red=Cloning site Green=Tags(s) MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVI NYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFD ESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057048 |
Locus ID | 51673 |
UniProt ID | Q9BW30 |
Refseq Size | 1055 |
Cytogenetics | 16q22.1 |
Refseq ORF | 528 |
Synonyms | CGI-38; p20; p25gamma; TPPP/p20 |
Summary | Binds tubulin and has microtubule bundling activity. May play a role in cell proliferation and mitosis.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414167 | TPPP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC414281 | TPPP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414167 | Transient overexpression lysate of tubulin polymerization-promoting protein family member 3 (TPPP3) |
CNY 3080.00 |
|
LY414281 | Transient overexpression lysate of tubulin polymerization-promoting protein family member 3 (TPPP3) |
CNY 3080.00 |
|
PH300020 | TPPP3 MS Standard C13 and N15-labeled recombinant protein (NP_057224) |
CNY 19520.00 |
|
PH312586 | TPPP3 MS Standard C13 and N15-labeled recombinant protein (NP_057048) |
CNY 19520.00 |
|
TP300020 | Recombinant protein of human tubulin polymerization-promoting protein family member 3 (TPPP3), 20 µg |
CNY 2900.00 |