TPPP3 (NM_016140) Human Mass Spec Standard
CAT＃: PH300020
TPPP3 MS Standard C13 and N15-labeled recombinant protein (NP_057224)
View other "TPPP3" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
热销推荐Specifications
| Product Data | |
| Description | TPPP3 MS Standard C13 and N15-labeled recombinant protein (NP_057224) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200020 |
| Predicted MW | 19 kDa |
| Protein Sequence |
>RC200020 protein sequence
Red=Cloning site Green=Tags(s) MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVI NYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFD ESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057224 |
| RefSeq Size | 1159 |
| RefSeq ORF | 528 |
| Synonyms | CGI-38; p20; p25gamma; TPPP/p20 |
| Locus ID | 51673 |
| Cytogenetics | 16q22.1 |
| Summary | Binds tubulin and has microtubule bundling activity. May play a role in cell proliferation and mitosis.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414167 | TPPP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC414281 | TPPP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414167 | Transient overexpression lysate of tubulin polymerization-promoting protein family member 3 (TPPP3) |
CNY 3080.00 |
|
| LY414281 | Transient overexpression lysate of tubulin polymerization-promoting protein family member 3 (TPPP3) |
CNY 3080.00 |
|
| PH312586 | TPPP3 MS Standard C13 and N15-labeled recombinant protein (NP_057048) |
CNY 19520.00 |
|
| TP300020 | Recombinant protein of human tubulin polymerization-promoting protein family member 3 (TPPP3), 20 µg |
CNY 2900.00 |
|
| TP312586 | Recombinant protein of human tubulin polymerization-promoting protein family member 3 (TPPP3), 20 µg |
CNY 2900.00 |
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
