GOLGA7 (NM_016099) Human Recombinant Protein
CAT#: TP312483
Recombinant protein of human golgi autoantigen, golgin subfamily a, 7 (GOLGA7), transcript variant 1, 20 µg
View other "GOLGA7" proteins (10)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212483 protein sequence
Red=Cloning site Green=Tags(s) MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCL ACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRGMSSGR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 15.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057183 |
Locus ID | 51125 |
UniProt ID | Q7Z5G4 |
Refseq Size | 1919 |
Cytogenetics | 8p11.21 |
Refseq ORF | 411 |
Synonyms | GCP16; GOLGA3AP1; GOLGA7A; HSPC041 |
Summary | May be involved in protein transport from Golgi to cell surface. The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414189 | GOLGA7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424147 | GOLGA7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432569 | GOLGA7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414189 | Transient overexpression lysate of golgin A7 (GOLGA7), transcript variant 1 |
CNY 3080.00 |
|
LY424147 | Transient overexpression lysate of golgin A7 (GOLGA7), transcript variant 2 |
CNY 3080.00 |
|
LY432569 | Transient overexpression lysate of golgin A7 (GOLGA7), transcript variant 3 |
CNY 3080.00 |
|
PH304399 | GOLGA7 MS Standard C13 and N15-labeled recombinant protein (NP_001002296) |
CNY 19520.00 |
|
PH312483 | GOLGA7 MS Standard C13 and N15-labeled recombinant protein (NP_057183) |
CNY 19520.00 |
|
TP304399 | Recombinant protein of human golgi autoantigen, golgin subfamily a, 7 (GOLGA7), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP329569 | Purified recombinant protein of Homo sapiens golgin A7 (GOLGA7), transcript variant 3, 20 µg |
CNY 2900.00 |