GOLGA7 (NM_001002296) Human Mass Spec Standard
CAT#: PH304399
GOLGA7 MS Standard C13 and N15-labeled recombinant protein (NP_001002296)
View other "GOLGA7" proteins (10)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | GOLGA7 MS Standard C13 and N15-labeled recombinant protein (NP_001002296) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204399 |
| Predicted MW | 15.8 kDa |
| Protein Sequence |
>RC204399 protein sequence
Red=Cloning site Green=Tags(s) MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCL ACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRGMSSGR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001002296 |
| RefSeq Size | 2042 |
| RefSeq ORF | 411 |
| Synonyms | GCP16; GOLGA3AP1; GOLGA7A; HSPC041 |
| Locus ID | 51125 |
| Cytogenetics | 8p11.21 |
| Summary | May be involved in protein transport from Golgi to cell surface. The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414189 | GOLGA7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424147 | GOLGA7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432569 | GOLGA7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414189 | Transient overexpression lysate of golgin A7 (GOLGA7), transcript variant 1 |
CNY 3080.00 |
|
| LY424147 | Transient overexpression lysate of golgin A7 (GOLGA7), transcript variant 2 |
CNY 3080.00 |
|
| LY432569 | Transient overexpression lysate of golgin A7 (GOLGA7), transcript variant 3 |
CNY 3080.00 |
|
| PH312483 | GOLGA7 MS Standard C13 and N15-labeled recombinant protein (NP_057183) |
CNY 19520.00 |
|
| TP304399 | Recombinant protein of human golgi autoantigen, golgin subfamily a, 7 (GOLGA7), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP312483 | Recombinant protein of human golgi autoantigen, golgin subfamily a, 7 (GOLGA7), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP329569 | Purified recombinant protein of Homo sapiens golgin A7 (GOLGA7), transcript variant 3, 20 µg |
CNY 2900.00 |
