Annexin A11 (ANXA11) (NM_001157) Human Recombinant Protein
CAT#: TP312191
Recombinant protein of human annexin A11 (ANXA11), transcript variant a, 20 µg
View other "Annexin A11" proteins (11)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212191 protein sequence
Red=Cloning site Green=Tags(s) MSYPGYPPPPGGYPPAAPGGGPWGGAAYPPPPSMPPIGLDNVATYAGQFNQDYLSGMAANMSGTFGGANM PNLYPGAPGAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPVPGQPMPPPGQQP PGAYPGQPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVTPAVPPTQFGSRGTITDAPGFDPLRDAEVLR KAMKGFGTDEQAIIDCLGSRSNKQRQQILLSFKTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDIYE IKEAIKGVGTDEACLIEILASRSNEHIRELNRAYKAEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDEST NVDMSLAQRDAQELYAAGENRLGTDESKFNAVLCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEE GMLAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSETDLLDIRSEYKRMYGKSLYHDISGDTS GDYRKILLKICGGND myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 54.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001148 |
Locus ID | 311 |
UniProt ID | P50995 |
Refseq Size | 2486 |
Cytogenetics | 10q22.3 |
Refseq ORF | 1515 |
Synonyms | ALS23; ANX11; CAP-50; CAP50 |
Summary | This gene encodes a member of the annexin family, a group of calcium-dependent phospholipid-binding proteins. Annexins have unique N-terminal domains and conserved C-terminal domains, which contain calcium-dependent phospholipid-binding sites. The encoded protein is a 56-kD antigen recognized by sera from patients with various autoimmune diseases. Several transcript variants encoding two different isoforms have been identified. [provided by RefSeq, Dec 2015] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403443 | ANXA11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC407850 | ANXA11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420097 | ANXA11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403443 | Transient overexpression lysate of annexin A11 (ANXA11), transcript variant c |
CNY 4840.00 |
|
LY407850 | Transient overexpression lysate of annexin A11 (ANXA11), transcript variant b |
CNY 3080.00 |
|
LY420097 | Transient overexpression lysate of annexin A11 (ANXA11), transcript variant a |
CNY 3080.00 |
|
PH303530 | ANXA11 MS Standard C13 and N15-labeled recombinant protein (NP_665875) |
CNY 19520.00 |
|
PH312191 | ANXA11 MS Standard C13 and N15-labeled recombinant protein (NP_001148) |
CNY 19520.00 |
|
PH323654 | ANXA11 MS Standard C13 and N15-labeled recombinant protein (NP_665876) |
CNY 19520.00 |
|
TP303530 | Recombinant protein of human annexin A11 (ANXA11), transcript variant b, 20 µg |
CNY 2900.00 |
|
TP323654 | Recombinant protein of human annexin A11 (ANXA11), transcript variant c, 20 µg |
CNY 2900.00 |
其它Annexin A11产品