Annexin A11 (ANXA11) (NM_001157) Human Mass Spec Standard
CAT#: PH312191
ANXA11 MS Standard C13 and N15-labeled recombinant protein (NP_001148)
View other "Annexin A11" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | ANXA11 MS Standard C13 and N15-labeled recombinant protein (NP_001148) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC212191 |
| Predicted MW | 54.4 kDa |
| Protein Sequence |
>RC212191 protein sequence
Red=Cloning site Green=Tags(s) MSYPGYPPPPGGYPPAAPGGGPWGGAAYPPPPSMPPIGLDNVATYAGQFNQDYLSGMAANMSGTFGGANM PNLYPGAPGAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPVPGQPMPPPGQQP PGAYPGQPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVTPAVPPTQFGSRGTITDAPGFDPLRDAEVLR KAMKGFGTDEQAIIDCLGSRSNKQRQQILLSFKTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDIYE IKEAIKGVGTDEACLIEILASRSNEHIRELNRAYKAEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDEST NVDMSLAQRDAQELYAAGENRLGTDESKFNAVLCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEE GMLAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSETDLLDIRSEYKRMYGKSLYHDISGDTS GDYRKILLKICGGND myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001148 |
| RefSeq Size | 2486 |
| RefSeq ORF | 1515 |
| Synonyms | ALS23; ANX11; CAP-50; CAP50 |
| Locus ID | 311 |
| Cytogenetics | 10q22.3 |
| Summary | This gene encodes a member of the annexin family, a group of calcium-dependent phospholipid-binding proteins. Annexins have unique N-terminal domains and conserved C-terminal domains, which contain calcium-dependent phospholipid-binding sites. The encoded protein is a 56-kD antigen recognized by sera from patients with various autoimmune diseases. Several transcript variants encoding two different isoforms have been identified. [provided by RefSeq, Dec 2015] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403443 | ANXA11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC407850 | ANXA11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420097 | ANXA11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403443 | Transient overexpression lysate of annexin A11 (ANXA11), transcript variant c |
CNY 4840.00 |
|
| LY407850 | Transient overexpression lysate of annexin A11 (ANXA11), transcript variant b |
CNY 3080.00 |
|
| LY420097 | Transient overexpression lysate of annexin A11 (ANXA11), transcript variant a |
CNY 3080.00 |
|
| PH303530 | ANXA11 MS Standard C13 and N15-labeled recombinant protein (NP_665875) |
CNY 19520.00 |
|
| PH323654 | ANXA11 MS Standard C13 and N15-labeled recombinant protein (NP_665876) |
CNY 19520.00 |
|
| TP303530 | Recombinant protein of human annexin A11 (ANXA11), transcript variant b, 20 µg |
CNY 2900.00 |
|
| TP312191 | Recombinant protein of human annexin A11 (ANXA11), transcript variant a, 20 µg |
CNY 2900.00 |
|
| TP323654 | Recombinant protein of human annexin A11 (ANXA11), transcript variant c, 20 µg |
CNY 2900.00 |
其它Annexin A11产品
