SOX6 (NM_033326) Human Recombinant Protein
CAT#: TP312046
Recombinant protein of human SRY (sex determining region Y)-box 6 (SOX6), transcript variant 2, 20 µg
View other "SOX6" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 1 publication. |
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212046 representing NM_033326
Red=Cloning site Green=Tags(s) MAAAAASGLSPLQLQQLYAAQLASMQVSPGAKMPSTPQPPNTAGTVSPTGIKNEKRGTSPVTQVKDEAAA QPLNLSSRPKTAEPVKSPTSPTQNLFPASKTSPVNLPNKSSIPSPIGGSLGRGSSLDILSSLNSPALFGD QDTVMKAIQEARKMREQIQREQQQQQPHGVDGKLSSINNMGLNSCRNEKERTRFENLGPQLTGKSNEDGK LGPGVIDLTRPEDAEGSKAMNGSARVYRDARGRASSEPHIKRPMNAFMVWAKDERRKILQAFPDMHNSNI SKILGSRWKSMSNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPKRTCIVDGKKLRIGEYKQLMRSRRQEM RQFFTVGQQPQIPITTGTGVVYPGAITMATTTPSPQMTSDCSSTSASPEPSLPVIQSTYGMKTDGGSLAG NEMINGEDEMEMYDDYEDDPKSDYSSENEAPEAVSANTRTRPLEQKLISEEDLAANDILDYKDDDDKV* myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 89.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_201583 |
Locus ID | 55553 |
UniProt ID | P35712 |
Refseq Size | 8865 |
Cytogenetics | 11p15.2 |
Refseq ORF | 2424 |
Synonyms | HSSOX6; SOXD; TOLCAS |
Summary | This gene encodes a member of the D subfamily of sex determining region y-related transcription factors that are characterized by a conserved DNA-binding domain termed the high mobility group box and by their ability to bind the minor groove of DNA. The encoded protein is a transcriptional activator that is required for normal development of the central nervous system, chondrogenesis and maintenance of cardiac and skeletal muscle cells. The encoded protein interacts with other family members to cooperatively activate gene expression. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Mar 2009] |
Protein Families | Transcription Factors |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
The transcription factor SOX6 contributes to the developmental origins of obesity by promoting adipogenesis.
,null,
Development (Cambridge, England)
,PubMed ID 26893351
[SOX6]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403243 | SOX6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY403243 | Transient overexpression lysate of SRY (sex determining region Y)-box 6 (SOX6), transcript variant 2 |
CNY 4840.00 |
|
PH311525 | SOX6 MS Standard C13 and N15-labeled recombinant protein (NP_059978) |
CNY 14250.00 |
|
PH312046 | SOX6 MS Standard C13 and N15-labeled recombinant protein (NP_201583) |
CNY 19520.00 |
|
TP311525 | Recombinant protein of human SRY (sex determining region Y)-box 6 (SOX6), transcript variant 1, 20 µg |
CNY 2900.00 |