SOX6 (NM_033326) Human Mass Spec Standard
CAT#: PH312046
SOX6 MS Standard C13 and N15-labeled recombinant protein (NP_201583)
View other "SOX6" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 4840.00
Specifications
Product Data | |
Description | SOX6 MS Standard C13 and N15-labeled recombinant protein (NP_201583) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212046 |
Predicted MW | 89.7 kDa |
Protein Sequence |
>RC212046 representing NM_033326
Red=Cloning site Green=Tags(s) MAAAAASGLSPLQLQQLYAAQLASMQVSPGAKMPSTPQPPNTAGTVSPTGIKNEKRGTSPVTQVKDEAAA QPLNLSSRPKTAEPVKSPTSPTQNLFPASKTSPVNLPNKSSIPSPIGGSLGRGSSLDILSSLNSPALFGD QDTVMKAIQEARKMREQIQREQQQQQPHGVDGKLSSINNMGLNSCRNEKERTRFENLGPQLTGKSNEDGK LGPGVIDLTRPEDAEGSKAMNGSARVYRDARGRASSEPHIKRPMNAFMVWAKDERRKILQAFPDMHNSNI SKILGSRWKSMSNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPKRTCIVDGKKLRIGEYKQLMRSRRQEM RQFFTVGQQPQIPITTGTGVVYPGAITMATTTPSPQMTSDCSSTSASPEPSLPVIQSTYGMKTDGGSLAG NEMINGEDEMEMYDDYEDDPKSDYSSENEAPEAVSANTRTRPLEQKLISEEDLAANDILDYKDDDDKV* myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_201583 |
RefSeq Size | 8865 |
RefSeq ORF | 2424 |
Synonyms | HSSOX6; SOXD; TOLCAS |
Locus ID | 55553 |
Cytogenetics | 11p15.2 |
Summary | This gene encodes a member of the D subfamily of sex determining region y-related transcription factors that are characterized by a conserved DNA-binding domain termed the high mobility group box and by their ability to bind the minor groove of DNA. The encoded protein is a transcriptional activator that is required for normal development of the central nervous system, chondrogenesis and maintenance of cardiac and skeletal muscle cells. The encoded protein interacts with other family members to cooperatively activate gene expression. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Mar 2009] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403243 | SOX6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY403243 | Transient overexpression lysate of SRY (sex determining region Y)-box 6 (SOX6), transcript variant 2 |
CNY 4840.00 |
|
PH311525 | SOX6 MS Standard C13 and N15-labeled recombinant protein (NP_059978) |
CNY 14250.00 |
|
TP311525 | Recombinant protein of human SRY (sex determining region Y)-box 6 (SOX6), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP312046 | Recombinant protein of human SRY (sex determining region Y)-box 6 (SOX6), transcript variant 2, 20 µg |
CNY 2900.00 |