ethanolamine kinase (ETNK1) (NM_001039481) Human Recombinant Protein
CAT#: TP311556
Recombinant protein of human ethanolamine kinase 1 (ETNK1), transcript variant 2, 20 µg
View other "ethanolamine kinase" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC211556 representing NM_001039481
Red=Cloning site Green=Tags(s) MLCGRPRSSSDNRNFLRERAGLSSAAVQTRIGNSAASRRSPAARPPVPAPPALPRGRPGTEGSTSLSAPA VLVVAVAVVVVVVSAVAWAMANYIHVPPGSPEVPKLNVTVQDQEEHRCREGALSLLQHLRPHWDPQEVTL QLFTDGITNKLIGCYVGNTMEDVVLVRIYGNKTELLVDRDEEVKSFRVLQAHGCAPQLYCTFNNGLCYEF IQGEALDPKHVCNPAIFSLSSLTLCKGKTTRCFGLTGCRGSRLLLSFF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 27.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001034570 |
| Locus ID | 55500 |
| UniProt ID | Q9HBU6 |
| Refseq Size | 910 |
| Cytogenetics | 12p12.1 |
| Refseq ORF | 774 |
| Synonyms | EKI; EKI 1; EKI1; Nbla10396 |
| Summary | This gene encodes an ethanolamine kinase, which functions in the first committed step of the phosphatidylethanolamine synthesis pathway. This cytosolic enzyme is specific for ethanolamine and exhibits negligible kinase activity on choline. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Glycerophospholipid metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC422057 | ETNK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY422057 | Transient overexpression lysate of ethanolamine kinase 1 (ETNK1), transcript variant 2 |
CNY 3080.00 |
|
| PH311556 | ETNK1 MS Standard C13 and N15-labeled recombinant protein (NP_001034570) |
CNY 19520.00 |
其它ethanolamine kinase产品
