ethanolamine kinase (ETNK1) (NM_001039481) Human Mass Spec Standard
CAT#: PH311556
ETNK1 MS Standard C13 and N15-labeled recombinant protein (NP_001034570)
View other "ethanolamine kinase" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | ETNK1 MS Standard C13 and N15-labeled recombinant protein (NP_001034570) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC211556 |
| Predicted MW | 27.8 kDa |
| Protein Sequence |
>RC211556 representing NM_001039481
Red=Cloning site Green=Tags(s) MLCGRPRSSSDNRNFLRERAGLSSAAVQTRIGNSAASRRSPAARPPVPAPPALPRGRPGTEGSTSLSAPA VLVVAVAVVVVVVSAVAWAMANYIHVPPGSPEVPKLNVTVQDQEEHRCREGALSLLQHLRPHWDPQEVTL QLFTDGITNKLIGCYVGNTMEDVVLVRIYGNKTELLVDRDEEVKSFRVLQAHGCAPQLYCTFNNGLCYEF IQGEALDPKHVCNPAIFSLSSLTLCKGKTTRCFGLTGCRGSRLLLSFF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001034570 |
| RefSeq Size | 910 |
| RefSeq ORF | 774 |
| Synonyms | EKI; EKI 1; EKI1; Nbla10396 |
| Locus ID | 55500 |
| Cytogenetics | 12p12.1 |
| Summary | This gene encodes an ethanolamine kinase, which functions in the first committed step of the phosphatidylethanolamine synthesis pathway. This cytosolic enzyme is specific for ethanolamine and exhibits negligible kinase activity on choline. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Glycerophospholipid metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC422057 | ETNK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY422057 | Transient overexpression lysate of ethanolamine kinase 1 (ETNK1), transcript variant 2 |
CNY 3080.00 |
|
| TP311556 | Recombinant protein of human ethanolamine kinase 1 (ETNK1), transcript variant 2, 20 µg |
CNY 2900.00 |
其它ethanolamine kinase产品
