REXO2 (NM_015523) Human Recombinant Protein
CAT#: TP311236
Recombinant protein of human REX2, RNA exonuclease 2 homolog (S. cerevisiae) (REXO2), 20 µg
View other "REXO2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC211236 protein sequence
Red=Cloning site Green=Tags(s) MLGGSLGSRLLRGVGGSHGRFGARGVREGGAAMAAGESMAQRMVWVDLEMTGLDIEKDQIIEMACLITDS DLNILAEGPNLIIKQPDELLDSMSDWCKEHHGKSGLTKAVKESTITLQQAEYEFLSFVRQQTPPGLCPLA GNSVHEDKKFLDKYMPQFMKHLHYRIIDVSTVKELCRRWYPEEYEFAPKKAASHRALDDISESIKELQFY RNNIFKKKIDEKKRKIIENGENEKTVS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 26.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_056338 |
| Locus ID | 25996 |
| UniProt ID | Q9Y3B8 |
| Refseq Size | 1171 |
| Cytogenetics | 11q23.2 |
| Refseq ORF | 711 |
| Synonyms | CGI-114; REX2; RFN; SFN |
| Summary | This gene encodes a 3'-to-5' exonuclease specific for small (primarily 5 nucleotides or less in length) single-stranded RNA and DNA oligomers. This protein may have a role in DNA repair, replication, and recombination, and in RNA processing and degradation. It may also be involved in resistance of human cells to UV-C-induced cell death through its role in the DNA repair process. [provided by RefSeq, Nov 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414494 | REXO2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414494 | Transient overexpression lysate of REX2, RNA exonuclease 2 homolog (S. cerevisiae) (REXO2) |
CNY 3080.00 |
|
| PH311236 | REXO2 MS Standard C13 and N15-labeled recombinant protein (NP_056338) |
CNY 19520.00 |
