REXO2 (NM_015523) Human Mass Spec Standard
CAT#: PH311236
REXO2 MS Standard C13 and N15-labeled recombinant protein (NP_056338)
View other "REXO2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | REXO2 MS Standard C13 and N15-labeled recombinant protein (NP_056338) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC211236 |
| Predicted MW | 26.8 kDa |
| Protein Sequence |
>RC211236 protein sequence
Red=Cloning site Green=Tags(s) MLGGSLGSRLLRGVGGSHGRFGARGVREGGAAMAAGESMAQRMVWVDLEMTGLDIEKDQIIEMACLITDS DLNILAEGPNLIIKQPDELLDSMSDWCKEHHGKSGLTKAVKESTITLQQAEYEFLSFVRQQTPPGLCPLA GNSVHEDKKFLDKYMPQFMKHLHYRIIDVSTVKELCRRWYPEEYEFAPKKAASHRALDDISESIKELQFY RNNIFKKKIDEKKRKIIENGENEKTVS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_056338 |
| RefSeq Size | 1171 |
| RefSeq ORF | 711 |
| Synonyms | CGI-114; REX2; RFN; SFN |
| Locus ID | 25996 |
| Cytogenetics | 11q23.2 |
| Summary | This gene encodes a 3'-to-5' exonuclease specific for small (primarily 5 nucleotides or less in length) single-stranded RNA and DNA oligomers. This protein may have a role in DNA repair, replication, and recombination, and in RNA processing and degradation. It may also be involved in resistance of human cells to UV-C-induced cell death through its role in the DNA repair process. [provided by RefSeq, Nov 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414494 | REXO2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414494 | Transient overexpression lysate of REX2, RNA exonuclease 2 homolog (S. cerevisiae) (REXO2) |
CNY 3080.00 |
|
| TP311236 | Recombinant protein of human REX2, RNA exonuclease 2 homolog (S. cerevisiae) (REXO2), 20 µg |
CNY 2900.00 |
