ZSCAN4 (NM_152677) Human Recombinant Protein
CAT#: TP311003
Recombinant protein of human zinc finger and SCAN domain containing 4 (ZSCAN4), 20 µg
View other "ZSCAN4" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC211003 protein sequence
Red=Cloning site Green=Tags(s) MALDLRTIFQCEPSENNLGSENSAFQQSQGPAVQREEGISEFSRMVLNSFQDSNNSYARQELQRLYRIFH SWLQPEKHSKDEIISLLVLEQFMIGGHCNDKASVKEKWKSSGKNLERFIEDLTDDSINPPALVHVHMQGQ EALFSEDMPLRDVIVHLTKQVNAQTTREANMGTPSQTSQDTSLETGQGYEDEQDGWNSSSKTTRVNENIT NQGNQIVSLIIIQEENGPRPEEGGVSSDNPYNSKRAELVTARSQEGSINGITFQGVPMVMGAGCISQPEQ SSPESALTHQSNEGNSTCEVHQKGSHGVQKSYKCEECPKVFKYLCHLLAHQRRHRNERPFVCPECQKGFF QISDLRVHQIIHTGKKPFTCSMCKKSFSHKTNLRSHERIHTGEKPYTCPFCKTSYRQSSTYHRHMRTHEK ITLPSVPSTPEAS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 48.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_689890 |
| Locus ID | 201516 |
| UniProt ID | Q8NAM6 |
| Refseq Size | 2260 |
| Cytogenetics | 19q13.43 |
| Refseq ORF | 1299 |
| Synonyms | ZNF494 |
| Summary | The ZSCAN4 gene encodes a protein involved in telomere maintenance and with a key role in the critical feature of mouse embryonic stem (ES) cells, namely, defying cellular senescence and maintaining normal karyotype for many cell divisions in culture (Zalzman et al., 2010 [PubMed 20336070]).[supplied by OMIM, May 2010] |
| Protein Families | Transcription Factors |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Zscan4 interacts directly with human Rap1 in cancer cells regardless of telomerase status
,null,
Cancer Biology & Therapy
,PubMed ID 24840609
[ZSCAN4]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407355 | ZSCAN4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407355 | Transient overexpression lysate of zinc finger and SCAN domain containing 4 (ZSCAN4) |
CNY 3080.00 |
|
| PH311003 | ZSCAN4 MS Standard C13 and N15-labeled recombinant protein (NP_689890) |
CNY 19520.00 |
