ZSCAN4 (NM_152677) Human Recombinant Protein
CAT#: TP311003
Recombinant protein of human zinc finger and SCAN domain containing 4 (ZSCAN4), 20 µg
View other "ZSCAN4" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 1 publication. |
CNY 600.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211003 protein sequence
Red=Cloning site Green=Tags(s) MALDLRTIFQCEPSENNLGSENSAFQQSQGPAVQREEGISEFSRMVLNSFQDSNNSYARQELQRLYRIFH SWLQPEKHSKDEIISLLVLEQFMIGGHCNDKASVKEKWKSSGKNLERFIEDLTDDSINPPALVHVHMQGQ EALFSEDMPLRDVIVHLTKQVNAQTTREANMGTPSQTSQDTSLETGQGYEDEQDGWNSSSKTTRVNENIT NQGNQIVSLIIIQEENGPRPEEGGVSSDNPYNSKRAELVTARSQEGSINGITFQGVPMVMGAGCISQPEQ SSPESALTHQSNEGNSTCEVHQKGSHGVQKSYKCEECPKVFKYLCHLLAHQRRHRNERPFVCPECQKGFF QISDLRVHQIIHTGKKPFTCSMCKKSFSHKTNLRSHERIHTGEKPYTCPFCKTSYRQSSTYHRHMRTHEK ITLPSVPSTPEAS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 48.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_689890 |
Locus ID | 201516 |
UniProt ID | Q8NAM6 |
Refseq Size | 2260 |
Cytogenetics | 19q13.43 |
Refseq ORF | 1299 |
Synonyms | ZNF494 |
Summary | The ZSCAN4 gene encodes a protein involved in telomere maintenance and with a key role in the critical feature of mouse embryonic stem (ES) cells, namely, defying cellular senescence and maintaining normal karyotype for many cell divisions in culture (Zalzman et al., 2010 [PubMed 20336070]).[supplied by OMIM, May 2010] |
Protein Families | Transcription Factors |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Zscan4 interacts directly with human Rap1 in cancer cells regardless of telomerase status
,null,
Cancer Biology & Therapy
,PubMed ID 24840609
[ZSCAN4]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407355 | ZSCAN4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407355 | Transient overexpression lysate of zinc finger and SCAN domain containing 4 (ZSCAN4) |
CNY 3080.00 |
|
PH311003 | ZSCAN4 MS Standard C13 and N15-labeled recombinant protein (NP_689890) |
CNY 19520.00 |