ZSCAN4 (NM_152677) Human Mass Spec Standard
CAT#: PH311003
ZSCAN4 MS Standard C13 and N15-labeled recombinant protein (NP_689890)
View other "ZSCAN4" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
| Cited in 2 publications. |
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | ZSCAN4 MS Standard C13 and N15-labeled recombinant protein (NP_689890) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC211003 |
| Predicted MW | 49 kDa |
| Protein Sequence |
>RC211003 protein sequence
Red=Cloning site Green=Tags(s) MALDLRTIFQCEPSENNLGSENSAFQQSQGPAVQREEGISEFSRMVLNSFQDSNNSYARQELQRLYRIFH SWLQPEKHSKDEIISLLVLEQFMIGGHCNDKASVKEKWKSSGKNLERFIEDLTDDSINPPALVHVHMQGQ EALFSEDMPLRDVIVHLTKQVNAQTTREANMGTPSQTSQDTSLETGQGYEDEQDGWNSSSKTTRVNENIT NQGNQIVSLIIIQEENGPRPEEGGVSSDNPYNSKRAELVTARSQEGSINGITFQGVPMVMGAGCISQPEQ SSPESALTHQSNEGNSTCEVHQKGSHGVQKSYKCEECPKVFKYLCHLLAHQRRHRNERPFVCPECQKGFF QISDLRVHQIIHTGKKPFTCSMCKKSFSHKTNLRSHERIHTGEKPYTCPFCKTSYRQSSTYHRHMRTHEK ITLPSVPSTPEAS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_689890 |
| RefSeq Size | 2260 |
| RefSeq ORF | 1299 |
| Synonyms | ZNF494 |
| Locus ID | 201516 |
| Cytogenetics | 19q13.43 |
| Summary | The ZSCAN4 gene encodes a protein involved in telomere maintenance and with a key role in the critical feature of mouse embryonic stem (ES) cells, namely, defying cellular senescence and maintaining normal karyotype for many cell divisions in culture (Zalzman et al., 2010 [PubMed 20336070]).[supplied by OMIM, May 2010] |
| Protein Families | Transcription Factors |
Citations (2)
| The use of this Proteins has been cited in the following citations: |
|---|
|
ZSCAN4 is negatively regulated by the ubiquitin-proteasome system and the E3 ubiquitin ligase RNF20
,null,
Biochemical and biophysical research communications
,PubMed ID 29477841
[ZSCAN4]
|
|
ZSCAN4 and TRF1: A functionally indirect interaction in cancer cells independent of telomerase activity.
,null,
Biochemical and biophysical research communications
,PubMed ID 26403970
[ZSCAN4]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407355 | ZSCAN4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407355 | Transient overexpression lysate of zinc finger and SCAN domain containing 4 (ZSCAN4) |
CNY 3080.00 |
|
| TP311003 | Recombinant protein of human zinc finger and SCAN domain containing 4 (ZSCAN4), 20 µg |
CNY 2900.00 |
