NRP2 (NM_201267) Human Recombinant Protein
CAT＃: TP310928
Recombinant protein of human neuropilin 2 (NRP2), transcript variant 5, 20 µg
View other "NRP2" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210928 protein sequence
Red=Cloning site Green=Tags(s) MDMFPLTWVFLALYFSRHQVRGQPDPPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVYAPEPNQKIVL NFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSMLYIKFTSDYARQGAGFSLRYE IFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTILAKPKMEIILQFLIFDLEHDPLQVGEGDCKY DWLDIWDGIPHVGPLIGKYCGTKTPSELRSSTGILSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVP LGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISR ETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIAL RLELFGCRVTDAPCSNMLGMLSGLIADSQISASSTQEYLWSPSAARLVSSRSGWFPRIPQAQPGEEWLQV DLGTPKTVKGVIIQGARGGDSITAVEARAFVRKFKVSYSLNGKDWEYIQDPRTQQPKLFEGNMHYDTPDI RRFDPIPAQYVRVYPERWSPAGIGMRLEVLGCDWTDSKPTVETLGPTVKSEETTTPYPTEEEATECGENC SFEDDKDLQLPSGFNCNFDFLEEPCGWMYDHAKWLRTTWASSSSPNDRTFPDDRNFLRLQSDSQREGQYA RLISPPVHLPRSPVCMEFQYQATGGRGVALQVVREASQESKLLWVIREDQGGEWKHGRIILPSYDMEYQI VFEGVIGKGRSGEIAIDDIRISTDVPLENCMEPISAFAGGTLLPGTEPTVDTVPMQPIPAYWYYVMAAGG AVLVLVSVALALVLHYHRFRYAAKKTDHSITYKTSHYTNGAPLAVEPTLTIKLEQDRGSHC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 98.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_957719 |
| Locus ID | 8828 |
| UniProt ID | O60462 |
| Refseq Size | 4148 |
| Cytogenetics | 2q33.3 |
| Refseq ORF | 2703 |
| Synonyms | NP2; NPN2; PRO2714; VEGF165R2 |
| Summary | This gene encodes a member of the neuropilin family of receptor proteins. The encoded transmembrane protein binds to SEMA3C protein {sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3C} and SEMA3F protein {sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3F}, and interacts with vascular endothelial growth factor (VEGF). This protein may play a role in cardiovascular development, axon guidance, and tumorigenesis. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401275 | NRP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC403706 | NRP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC404506 | NRP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC430844 | NRP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401275 | Transient overexpression lysate of neuropilin 2 (NRP2), transcript variant 2 |
CNY 4840.00 |
|
| LY403706 | Transient overexpression lysate of neuropilin 2 (NRP2), transcript variant 1 |
CNY 4840.00 |
|
| LY404506 | Transient overexpression lysate of neuropilin 2 (NRP2), transcript variant 5 |
CNY 3080.00 |
|
| LY430844 | Transient overexpression lysate of neuropilin 2 (NRP2), transcript variant 6 |
CNY 3080.00 |
|
| PH310928 | NRP2 MS Standard C13 and N15-labeled recombinant protein (NP_957719) |
CNY 19520.00 |
|
| PH320920 | NRP2 MS Standard C13 and N15-labeled recombinant protein (NP_957718) |
CNY 19520.00 |
|
| TP320920 | Recombinant protein of human neuropilin 2 (NRP2), transcript variant 1, 20 µg |
CNY 2900.00 |
