NRP2 (NM_201266) Human Mass Spec Standard
CAT＃: PH320920
NRP2 MS Standard C13 and N15-labeled recombinant protein (NP_957718)
View other "NRP2" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
| Cited in 1 publication. |
Product images
Specifications
| Product Data | |
| Description | NRP2 MS Standard C13 and N15-labeled recombinant protein (NP_957718) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC220920 |
| Predicted MW | 102.3 kDa |
| Protein Sequence |
>RC220920 representing NM_201266
Red=Cloning site Green=Tags(s) MTFYSPAVMNYSVPGSTSNLDGGPVRLSTSPNVLWPTSGHLSPLATHCQSSLLYAEPQKSPWCEARSLEH TLPVNRETLKRKLSGSSCASPVTSPNAKRDAHFCPVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYIC PATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRIVRRQRSSSEQVHCLSKAKRNGGHAPRV KELLLSTLSPEQLVLTLLEAEPPNVLVSRPSMPFTEASMMMSLTKLADKELVHMIGWAKKIPGFVELSLL DQVRLLESCWMEVLMVGLMWRSIDHPGKLIFAPDLVLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHK EYLCVKAMILLNSSMYPLASANQEAESSRKLTHLLNAVTDALVWVIAKSGISSQQQSVRLANLLMLLSHV RHISNKGMEHLLSMKCKNVVPVYDLLLEMLNAHTLRGYKSSISGSECSSTEDSKNKESSQNLQSQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_957718 |
| RefSeq Size | 6671 |
| RefSeq ORF | 2793 |
| Synonyms | NP2; NPN2; PRO2714; VEGF165R2 |
| Locus ID | 8828 |
| Cytogenetics | 2q33.3 |
| Summary | This gene encodes a member of the neuropilin family of receptor proteins. The encoded transmembrane protein binds to SEMA3C protein {sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3C} and SEMA3F protein {sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3F}, and interacts with vascular endothelial growth factor (VEGF). This protein may play a role in cardiovascular development, axon guidance, and tumorigenesis. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transmembrane |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Promotion of metastasis of thyroid cancer cells via NRP-2-mediated induction
,null,
Oncology Letters
,PubMed ID 27895796
[NRP2]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401275 | NRP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC403706 | NRP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC404506 | NRP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC430844 | NRP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401275 | Transient overexpression lysate of neuropilin 2 (NRP2), transcript variant 2 |
CNY 4840.00 |
|
| LY403706 | Transient overexpression lysate of neuropilin 2 (NRP2), transcript variant 1 |
CNY 4840.00 |
|
| LY404506 | Transient overexpression lysate of neuropilin 2 (NRP2), transcript variant 5 |
CNY 3080.00 |
|
| LY430844 | Transient overexpression lysate of neuropilin 2 (NRP2), transcript variant 6 |
CNY 3080.00 |
|
| PH310928 | NRP2 MS Standard C13 and N15-labeled recombinant protein (NP_957719) |
CNY 19520.00 |
|
| TP310928 | Recombinant protein of human neuropilin 2 (NRP2), transcript variant 5, 20 µg |
CNY 2900.00 |
|
| TP320920 | Recombinant protein of human neuropilin 2 (NRP2), transcript variant 1, 20 µg |
CNY 2900.00 |
