NDUF3 (NDUFAF3) (NM_199069) Human Recombinant Protein
CAT＃: TP310699
Recombinant protein of human chromosome 3 open reading frame 60 (C3orf60), transcript variant 1, 20 µg
View other "NDUF3" proteins (16)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210699 protein sequence
Red=Cloning site Green=Tags(s) MYIDSYNSRGFMINGNRVLGPCALLPHSVVQWNVGSHQDITEDSFSLFWLLEPRIEIVVVGTGDRTERLQ SQVLQAMRQRGIAVEVQDTPNACATFNFLCHEGRVTGAALIPPPGGTSLTSLGQAAQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 20.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_951032 |
| Locus ID | 25915 |
| UniProt ID | Q9BU61 |
| Refseq Size | 1387 |
| Cytogenetics | 3p21.31 |
| Refseq ORF | 381 |
| Synonyms | 2P1; C3orf60; E3-3; MC1DN18 |
| Summary | This gene encodes a mitochondrial complex I assembly protein that interacts with complex I subunits. Mutations in this gene cause mitochondrial complex I deficiency, a fatal neonatal disorder of the oxidative phosphorylation system. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404729 | NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404730 | NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404732 | NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404733 | NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404729 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
| LY404730 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3080.00 |
|
| LY404732 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 3 |
CNY 3080.00 |
|
| LY404733 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 4 |
CNY 3080.00 |
|
| PH302480 | NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951056) |
CNY 14250.00 |
|
| PH310699 | NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951032) |
CNY 19520.00 |
|
| PH317632 | NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951033) |
CNY 14250.00 |
|
| PH317754 | NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951047) |
CNY 14250.00 |
|
| TP302480 | Purified recombinant protein of Homo sapiens chromosome 3 open reading frame 60 (C3orf60), transcript variant 4, 20 µg |
CNY 2900.00 |
|
| TP317632 | Purified recombinant protein of Homo sapiens chromosome 3 open reading frame 60 (C3orf60), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP317754 | Purified recombinant protein of Homo sapiens chromosome 3 open reading frame 60 (C3orf60), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP318529 | Recombinant protein of human chromosome 3 open reading frame 60 (C3orf60), transcript variant 5, 20 µg |
CNY 2900.00 |
