NDUF3 (NDUFAF3) (NM_199074) Human Mass Spec Standard
CAT#: PH302480
NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951056)
View other "NDUF3" proteins (16)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951056) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202480 |
| Predicted MW | 20.4 kDa |
| Protein Sequence |
>RC202480 protein sequence
Red=Cloning site Green=Tags(s) MATALALRSLYRARPSLRCPPVELPWAPRRGHRLSPADDELYQRTRISLLQREAAQAMYIDSYNSRGFMI NGNRVLGPCALLPHSVVQWNVGSHQDITEDSFSLFWLLEPRIEIVVVGTGDRTERLQSQVLQAMRQRGIA VEVQDTPNACATFNFLCHEGRVTGAALIPPPGGTSLTSLGQAAQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_951056 |
| RefSeq Size | 902 |
| RefSeq ORF | 552 |
| Synonyms | 2P1; C3orf60; E3-3; MC1DN18 |
| Locus ID | 25915 |
| Cytogenetics | 3p21.31 |
| Summary | This gene encodes a mitochondrial complex I assembly protein that interacts with complex I subunits. Mutations in this gene cause mitochondrial complex I deficiency, a fatal neonatal disorder of the oxidative phosphorylation system. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404729 | NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404730 | NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404732 | NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404733 | NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404729 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
| LY404730 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3080.00 |
|
| LY404732 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 3 |
CNY 3080.00 |
|
| LY404733 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 4 |
CNY 3080.00 |
|
| PH310699 | NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951032) |
CNY 19520.00 |
|
| PH317632 | NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951033) |
CNY 14250.00 |
|
| PH317754 | NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951047) |
CNY 14250.00 |
|
| TP302480 | Purified recombinant protein of Homo sapiens chromosome 3 open reading frame 60 (C3orf60), transcript variant 4, 20 µg |
CNY 2900.00 |
|
| TP310699 | Recombinant protein of human chromosome 3 open reading frame 60 (C3orf60), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP317632 | Purified recombinant protein of Homo sapiens chromosome 3 open reading frame 60 (C3orf60), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP317754 | Purified recombinant protein of Homo sapiens chromosome 3 open reading frame 60 (C3orf60), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP318529 | Recombinant protein of human chromosome 3 open reading frame 60 (C3orf60), transcript variant 5, 20 µg |
CNY 2900.00 |
