TDP43 (TARDBP) (NM_007375) Human Recombinant Protein
CAT#: TP310639
Recombinant protein of human TAR DNA binding protein (TARDBP), 20 µg
View other "TDP43" proteins (4)
| Need it in bulk or customized? Get a free quote | Avi-tag Biotinylated Protein Get a free quote | 
CNY 2900.00
| Cited in 4 publications. | 
CNY 600.00
                                                
                                                
                                                
                                                    CNY 1999.00 
                                                    
                                                    CNY 3600.00
                                                
                                            
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | >RC210639 protein sequence Red=Cloning site Green=Tags(s) MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGN LVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLK TGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREF FSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNP GGFGNQGGFGNSRGGGAGLGNNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPS GNNQNQGNMQREPNQAFGSGNNSYSGSNSGAAIGWGSASNAGSGSGFNGGFGSSMDSKSSGWGM myc-FLAG tag | 
| Tag | C-Myc/DDK | 
| Predicted MW | 44.6 kDa | 
| Concentration | >0.1 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Bioactivity | In vitro binding assay (PMID: 25738460) | 
| Reference Data | |
| RefSeq | NP_031401 | 
| Locus ID | 23435 | 
| UniProt ID | Q13148 | 
| Refseq Size | 4236 | 
| Cytogenetics | 1p36.22 | 
| Refseq ORF | 1242 | 
| Synonyms | ALS10; TDP-43 | 
| Summary | HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20. [provided by RefSeq, Jul 2008] | 
| Protein Families | Transcription Factors | 
Citations (4)
| The use of this Proteins has been cited in the following citations: | 
|---|
| TDP-43 stabilizes G3BP1 mRNA: relevance to amyotrophic lateral sclerosis/frontotemporal dementia
                                                ,Sidibé, H;Khalfallah, Y;Xiao, S;Gómez, NB;Fakim, H;Tank, EMH;Tomasso, GD;Bareke, E;Aulas, A;McKeever, PM;Melamed, Z;Destroimaisons, L;Deshaies, JE;Zinman, L;Parker, JA;Legault, P;Tétreault, M;Barmada, SJ;Robertson, J;Velde, CV;,
                                                Brain : a journal of neurology
                                                ,PubMed ID 34115105
                                                [TARDBP] | 
| A Liver-Enriched Long Non-Coding RNA, lncLSTR, Regulates Systemic Lipid Metabolism in Mice
                                                ,Li, P;Ruan, X;Yang, L;Kiesewetter, K;Zhao, Y;Luo, H;Chen, Y;Gucek, M;Zhu, J;Cao, H;,
                                                Cell Metab.
                                                ,PubMed ID 25738460
                                                [TARDBP] | 
| Full-length TDP-43 forms toxic amyloid oligomers that are present in frontotemporal lobar dementia-TDP patients
                                                ,Fang, YS;Tsai, KJ;Chang, YJ;Kao, P;Woods, R;Kuo, PH;Wu, CC;Liao, JY;Chou, SC;Lin, V;Jin, LW;Yuan, HS;Cheng, IH;Tu, PH;Chen, YR;,
                                                Nat Commun
                                                ,PubMed ID 25215604
                                                [TARDBP] | 
| Dual vulnerability of TDP-43 to calpain and caspase-3 proteolysis after neurotoxic conditions and traumatic brain injury
                                                ,Yang, Z;Lin, F;Robertson, CS;Wang, KK;,
                                                J. Cereb. Blood Flow Metab.
                                                ,PubMed ID 24917042
                                                [TARDBP] | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC402137 | TARDBP HEK293T cell transient overexpression lysate (as WB positive control) | CNY 900.00 | |
| LY402137 | Transient overexpression lysate of TAR DNA binding protein (TARDBP) | CNY 3080.00 | |
| PH310639 | TARDBP MS Standard C13 and N15-labeled recombinant protein (NP_031401) | CNY 19520.00 | |
| TP710010 | Recombinant protein of human TAR DNA binding protein (TARDBP), full length, with C-terminal DDK tag,expressed in sf9 cells | CNY 4020.00 | 


 
                        

 热销推荐
热销推荐 
        