TDP43 (TARDBP) (NM_007375) Human Mass Spec Standard
CAT#: PH310639
TARDBP MS Standard C13 and N15-labeled recombinant protein (NP_031401)
View other "TDP43" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 3600.00
Specifications
| Product Data | |
| Description | TARDBP MS Standard C13 and N15-labeled recombinant protein (NP_031401) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210639 |
| Predicted MW | 44.7 kDa |
| Protein Sequence |
>RC210639 protein sequence
Red=Cloning site Green=Tags(s) MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGN LVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLK TGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREF FSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNP GGFGNQGGFGNSRGGGAGLGNNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPS GNNQNQGNMQREPNQAFGSGNNSYSGSNSGAAIGWGSASNAGSGSGFNGGFGSSMDSKSSGWGM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_031401 |
| RefSeq Size | 4236 |
| RefSeq ORF | 1242 |
| Synonyms | ALS10; TDP-43 |
| Locus ID | 23435 |
| Cytogenetics | 1p36.22 |
| Summary | HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20. [provided by RefSeq, Jul 2008] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402137 | TARDBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402137 | Transient overexpression lysate of TAR DNA binding protein (TARDBP) |
CNY 3080.00 |
|
| TP310639 | Recombinant protein of human TAR DNA binding protein (TARDBP), 20 µg |
CNY 2900.00 |
|
| TP710010 | Recombinant protein of human TAR DNA binding protein (TARDBP), full length, with C-terminal DDK tag,expressed in sf9 cells |
CNY 4020.00 |


