Proteinase Activated Receptor 4 (F2RL3) (NM_003950) Human Recombinant Protein
CAT#: TP310404
Recombinant protein of human coagulation factor II (thrombin) receptor-like 3 (F2RL3), 20 µg
View other "Proteinase Activated Receptor 4" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210404 representing NM_003950
Red=Cloning site Green=Tags(s) MWGRLLLWPLVLGFSLSGGTQTPSVYDESGSTGGGDDSTPSILPAPRGYPGQVCANDSDTLELPDSSRAL LLGWVPTRLVPALYGLVLVVGLPANGLALWVLATQAPRLPSTMLLMNLAAADLLLALALPPRIAYHLRGQ RWPFGEAACRLATAALYGHMYGSVLLLAAVSLDRYLALVHPLRARALRGRRLALGLCMAAWLMAAALALP LTLQRQTFRLARSDRVLCHDALPLDAQASHWQPAFTCLALLGCFLPLLAMLLCYGATLHTLAASGRRYGH ALRLTAVVLASAVAFFVPSNLLLLLHYSDPSPSAWGNLYGAYVPSLALSTLNSCVDPFIYYYVSAEFRDK VRAGLFQRSPGDTVASKASAEGGSRGMGTHSSLLQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 36.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003941 |
Locus ID | 9002 |
UniProt ID | Q96RI0 |
Refseq Size | 2731 |
Cytogenetics | 19p13.11 |
Refseq ORF | 1155 |
Synonyms | PAR4 |
Summary | This gene encodes a member of the protease-activated receptor subfamily, part of the G-protein coupled receptor 1 family of proteins. The encoded receptor is proteolytically processed to reveal an extracellular N-terminal tethered ligand that binds to and activates the receptor. This receptor plays a role in blood coagulation, inflammation and response to pain. Hypomethylation at this gene may be associated with lung cancer in human patients. [provided by RefSeq, Sep 2016] |
Protein Families | Druggable Genome, GPCR, Transmembrane |
Protein Pathways | Neuroactive ligand-receptor interaction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401297 | F2RL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401297 | Transient overexpression lysate of coagulation factor II (thrombin) receptor-like 3 (F2RL3) |
CNY 3080.00 |
|
PH310404 | F2RL3 MS Standard C13 and N15-labeled recombinant protein (NP_003941) |
CNY 19520.00 |
其它Proteinase Activated Receptor 4产品