Proteinase Activated Receptor 4 (F2RL3) (NM_003950) Human Mass Spec Standard
CAT#: PH310404
F2RL3 MS Standard C13 and N15-labeled recombinant protein (NP_003941)
View other "Proteinase Activated Receptor 4" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | F2RL3 MS Standard C13 and N15-labeled recombinant protein (NP_003941) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210404 |
| Predicted MW | 41.13 kDa |
| Protein Sequence |
>RC210404 representing NM_003950
Red=Cloning site Green=Tags(s) MWGRLLLWPLVLGFSLSGGTQTPSVYDESGSTGGGDDSTPSILPAPRGYPGQVCANDSDTLELPDSSRAL LLGWVPTRLVPALYGLVLVVGLPANGLALWVLATQAPRLPSTMLLMNLAAADLLLALALPPRIAYHLRGQ RWPFGEAACRLATAALYGHMYGSVLLLAAVSLDRYLALVHPLRARALRGRRLALGLCMAAWLMAAALALP LTLQRQTFRLARSDRVLCHDALPLDAQASHWQPAFTCLALLGCFLPLLAMLLCYGATLHTLAASGRRYGH ALRLTAVVLASAVAFFVPSNLLLLLHYSDPSPSAWGNLYGAYVPSLALSTLNSCVDPFIYYYVSAEFRDK VRAGLFQRSPGDTVASKASAEGGSRGMGTHSSLLQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003941 |
| RefSeq Size | 2731 |
| RefSeq ORF | 1155 |
| Synonyms | PAR4 |
| Locus ID | 9002 |
| Cytogenetics | 19p13.11 |
| Summary | This gene encodes a member of the protease-activated receptor subfamily, part of the G-protein coupled receptor 1 family of proteins. The encoded receptor is proteolytically processed to reveal an extracellular N-terminal tethered ligand that binds to and activates the receptor. This receptor plays a role in blood coagulation, inflammation and response to pain. Hypomethylation at this gene may be associated with lung cancer in human patients. [provided by RefSeq, Sep 2016] |
| Protein Families | Druggable Genome, GPCR, Transmembrane |
| Protein Pathways | Neuroactive ligand-receptor interaction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401297 | F2RL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401297 | Transient overexpression lysate of coagulation factor II (thrombin) receptor-like 3 (F2RL3) |
CNY 3080.00 |
|
| TP310404 | Recombinant protein of human coagulation factor II (thrombin) receptor-like 3 (F2RL3), 20 µg |
CNY 2900.00 |
其它Proteinase Activated Receptor 4产品
