SPIN2B (NM_001006681) Human Recombinant Protein
CAT#: TP310041
Recombinant protein of human spindlin family, member 2B (SPIN2B), transcript variant 1, 20 µg
View other "SPIN2B" proteins (7)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC210041 protein sequence 
Red=Cloning site Green=Tags(s) MKTPNAQEAEGQQTRAAAGRATGSANMTKKKVSQKKQRGRPSSQPRRNIVGCRISHGWKEGDEPITQWKG TVLDQVPINPSLYLVKYDGIDCVYGLELHRDERVLSLKILSDRVASSHISDANLANTIIGKAVEHMFEGE HGSKDEWRGMVLAQAPIMKAWFYITYEKDPVLYMYQLLDDYKEGDLRIMPESSESPPTEREPGGVVDGLI GKHVEYTKEDGSKRIGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKKS myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 29 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_001006682 | 
| Locus ID | 474343 | 
| UniProt ID | Q9BPZ2 | 
| Refseq Size | 1277 | 
| Cytogenetics | Xp11.21 | 
| Refseq ORF | 774 | 
| Synonyms | dJ323P24.2; SPIN-2; SPIN-2B; SPIN2_duplicate; TDRD26 | 
| Summary | Involved in the regulation of cell cycle progression, this activity is related to the inhibition of apoptosis following the removal of essential growth factors (PubMed:12145692). Exhibits H3K4me3-binding activity (PubMed:29061846).[UniProtKB/Swiss-Prot Function] | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC423547 | SPIN2B HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC423549 | SPIN2B HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY423547 | Transient overexpression lysate of spindlin family, member 2B (SPIN2B), transcript variant 1 | 
                                                     CNY 3080.00  | 
                                            |
| LY423549 | Transient overexpression lysate of spindlin family, member 2B (SPIN2B), transcript variant 3 | 
                                                     CNY 3080.00  | 
                                            |
| PH310041 | SPIN2B MS Standard C13 and N15-labeled recombinant protein (NP_001006682) | 
                                                     CNY 19520.00  | 
                                            |
| PH313224 | SPIN2B MS Standard C13 and N15-labeled recombinant protein (NP_001006684) | 
                                                     CNY 19520.00  | 
                                            |
| TP313224 | Recombinant protein of human spindlin family, member 2B (SPIN2B), transcript variant 3, 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            
