SPIN2B (NM_001006683) Human Mass Spec Standard
CAT#: PH313224
SPIN2B MS Standard C13 and N15-labeled recombinant protein (NP_001006684)
View other "SPIN2B" proteins (7)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
Specifications
| Product Data | |
| Description | SPIN2B MS Standard C13 and N15-labeled recombinant protein (NP_001006684) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC213224 | 
| Predicted MW | 29.2 kDa | 
| Protein Sequence | 
                 >RC213224 protein sequence 
Red=Cloning site Green=Tags(s) MKTPNAQEAEGQQTRAAAGRATGSANMTKKKVSQKKQRGRPSSQPRRNIVGCRISHGWKEGDEPITQWKG TVLDQVPINPSLYLVKYDGIDCVYGLELHRDERVLSLKILSDRVASSHISDANLANTIIGKAVEHMFEGE HGSKDEWRGMVLAQAPIMKAWFYITYEKDPVLYMYQLLDDYKEGDLRIMPESSESPPTEREPGGVVDGLI GKHVEYTKEDGSKRIGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKKS myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_001006684 | 
| RefSeq Size | 1216 | 
| RefSeq ORF | 774 | 
| Synonyms | dJ323P24.2; SPIN-2; SPIN-2B; SPIN2_duplicate; TDRD26 | 
| Locus ID | 474343 | 
| Cytogenetics | Xp11.21 | 
| Summary | Involved in the regulation of cell cycle progression, this activity is related to the inhibition of apoptosis following the removal of essential growth factors (PubMed:12145692). Exhibits H3K4me3-binding activity (PubMed:29061846).[UniProtKB/Swiss-Prot Function] | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC423547 | SPIN2B HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC423549 | SPIN2B HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY423547 | Transient overexpression lysate of spindlin family, member 2B (SPIN2B), transcript variant 1 | 
                                                     CNY 3080.00  | 
                                            |
| LY423549 | Transient overexpression lysate of spindlin family, member 2B (SPIN2B), transcript variant 3 | 
                                                     CNY 3080.00  | 
                                            |
| PH310041 | SPIN2B MS Standard C13 and N15-labeled recombinant protein (NP_001006682) | 
                                                     CNY 19520.00  | 
                                            |
| TP310041 | Recombinant protein of human spindlin family, member 2B (SPIN2B), transcript variant 1, 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            |
| TP313224 | Recombinant protein of human spindlin family, member 2B (SPIN2B), transcript variant 3, 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            
