PYCR1 (NM_006907) Human Recombinant Protein
CAT＃: TP310027
Recombinant protein of human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 1, 20 µg
View other "PYCR1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210027 representing NM_006907
Red=Cloning site Green=Tags(s) MSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKETVQHSDVLFLAV KPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTH AQVEDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQAL LGAAKMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIRTRELQSMADQEQVSPA AIKKTILDKVKLDSPAGTALSPSGHTKLLPRSLAPAGKD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 33.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_008838 |
| Locus ID | 5831 |
| UniProt ID | P32322 |
| Refseq Size | 2059 |
| Cytogenetics | 17q25.3 |
| Refseq ORF | 957 |
| Synonyms | ARCL2B; ARCL3B; P5C; P5CR; PIG45; PP222; PRO3; PYCR |
| Summary | This gene encodes an enzyme that catalyzes the NAD(P)H-dependent conversion of pyrroline-5-carboxylate to proline. This enzyme may also play a physiologic role in the generation of NADP(+) in some cell types. The protein forms a homopolymer and localizes to the mitochondrion. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013] |
| Protein Pathways | Arginine and proline metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406968 | PYCR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC416328 | PYCR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406968 | Transient overexpression lysate of pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 2 |
CNY 3080.00 |
|
| LY416328 | Transient overexpression lysate of pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 1 |
CNY 3080.00 |
|
| PH310027 | PYCR1 MS Standard C13 and N15-labeled recombinant protein (NP_008838) |
CNY 19520.00 |
|
| PH316359 | PYCR1 MS Standard C13 and N15-labeled recombinant protein (NP_722546) |
CNY 19520.00 |
|
| TP316359 | Recombinant protein of human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 2, 20 µg |
CNY 2900.00 |
PYCR1 mouse monoclonal antibody,clone OTI4F2
