PYCR1 (NM_153824) Human Mass Spec Standard
CAT＃: PH316359
PYCR1 MS Standard C13 and N15-labeled recombinant protein (NP_722546)
View other "PYCR1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | PYCR1 MS Standard C13 and N15-labeled recombinant protein (NP_722546) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC216359 |
| Predicted MW | 33.2 kDa |
| Protein Sequence |
>RC216359 representing NM_153824
Red=Cloning site Green=Tags(s) MSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKETVQHSDVLFLAV KPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTH AQVEDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQAL LGAAKMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIRTRELQSMADQEQVSPA AIKKTILDKDHLPLELGSPEGLHPLLLQYQLARAPS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_722546 |
| RefSeq Size | 1768 |
| RefSeq ORF | 948 |
| Synonyms | ARCL2B; ARCL3B; P5C; P5CR; PIG45; PP222; PRO3; PYCR |
| Locus ID | 5831 |
| Cytogenetics | 17q25.3 |
| Summary | This gene encodes an enzyme that catalyzes the NAD(P)H-dependent conversion of pyrroline-5-carboxylate to proline. This enzyme may also play a physiologic role in the generation of NADP(+) in some cell types. The protein forms a homopolymer and localizes to the mitochondrion. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013] |
| Protein Pathways | Arginine and proline metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406968 | PYCR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC416328 | PYCR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406968 | Transient overexpression lysate of pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 2 |
CNY 3080.00 |
|
| LY416328 | Transient overexpression lysate of pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 1 |
CNY 3080.00 |
|
| PH310027 | PYCR1 MS Standard C13 and N15-labeled recombinant protein (NP_008838) |
CNY 19520.00 |
|
| TP310027 | Recombinant protein of human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP316359 | Recombinant protein of human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 2, 20 µg |
CNY 2900.00 |
Recombinant protein of human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 2, 100 µg
