AK2 (NM_001625) Human Recombinant Protein
CAT#: TP309974
Recombinant protein of human adenylate kinase 2 (AK2), transcript variant AK2A, 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209974 protein sequence
Red=Cloning site Green=Tags(s) MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDA GKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRIT GRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAI DASQTPDVVFASILAAFSKATCKDLVMFI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001616 |
Locus ID | 204 |
UniProt ID | P54819 |
Refseq Size | 2759 |
Cytogenetics | 1p35.1 |
Refseq ORF | 717 |
Synonyms | ADK2 |
Summary | Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates; this gene encodes isozyme 2. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis. Mutations in this gene are the cause of reticular dysgenesis. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 1 and 2.[provided by RefSeq, Nov 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Purine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415600 | AK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419835 | AK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415600 | Transient overexpression lysate of adenylate kinase 2 (AK2), transcript variant AK2B |
CNY 3080.00 |
|
LY419835 | Transient overexpression lysate of adenylate kinase 2 (AK2), transcript variant AK2A |
CNY 3080.00 |
|
PH309974 | AK2 MS Standard C13 and N15-labeled recombinant protein (NP_001616) |
CNY 19520.00 |