AK2 (NM_001625) Human Mass Spec Standard
CAT#: PH309974
AK2 MS Standard C13 and N15-labeled recombinant protein (NP_001616)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | AK2 MS Standard C13 and N15-labeled recombinant protein (NP_001616) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209974 |
| Predicted MW | 26.5 kDa |
| Protein Sequence |
>RC209974 protein sequence
Red=Cloning site Green=Tags(s) MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDA GKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRIT GRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAI DASQTPDVVFASILAAFSKATCKDLVMFI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001616 |
| RefSeq Size | 2759 |
| RefSeq ORF | 717 |
| Synonyms | ADK2 |
| Locus ID | 204 |
| Cytogenetics | 1p35.1 |
| Summary | Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates; this gene encodes isozyme 2. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis. Mutations in this gene are the cause of reticular dysgenesis. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 1 and 2.[provided by RefSeq, Nov 2010] |
| Protein Families | Druggable Genome |
| Protein Pathways | Metabolic pathways, Purine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415600 | AK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419835 | AK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415600 | Transient overexpression lysate of adenylate kinase 2 (AK2), transcript variant AK2B |
CNY 3080.00 |
|
| LY419835 | Transient overexpression lysate of adenylate kinase 2 (AK2), transcript variant AK2A |
CNY 3080.00 |
|
| TP309974 | Recombinant protein of human adenylate kinase 2 (AK2), transcript variant AK2A, 20 µg |
CNY 2900.00 |
