C8ORF41 (TTI2) (NM_025115) Human Recombinant Protein
CAT#: TP309782
Recombinant protein of human chromosome 8 open reading frame 41 (C8orf41), transcript variant 2, 20 µg
View other "C8ORF41" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC209782 protein sequence
Red=Cloning site Green=Tags(s) MELDSALEAPSQEDSNLSEELSHSAFGQAFSKILHCLARPEARRGNVKDAVLKDLGDLIEATEFDRLFEG TGARLRGMPETLGQVAKALEKYAAPSKEEEGGGDGHSEAAEKAAQVGLLFLKLLGKVETAKNSLVGPAWQ TGLHHLAGPVYIFAITHSLEQPWTTPRSREVAREVLTSLLQVTECGSVAGFLHGENEDEKGRLSVILGLL KPDLYKESWKNNPAIKHVFSWTLQQVTRPWLSQHLERVLPASLVISDDYQTENKILGVHCLHHIVLNVPA ADLLQYNRAQVLYHAISNHLYTPEHHLIQAVLLCLLDLFPILEKTLHWKGDGARPTTHCDEVLRLILTHM EPEHRLLLRRTYARNLPAFVNRLGILTVRHLKRLERVIIGYLEVYDGPEEEARLKILETLKLLMQHTWPR VSCRLVVLLKALLKLICDVARDPNLTPESVKSALLQEATDCLILLDRCSQGRVKGLLAKIPQSCEDRKVV NYIRKVQQVSEGAPYNGT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 56.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_079391 |
| Locus ID | 80185 |
| UniProt ID | Q6NXR4 |
| Refseq Size | 2763 |
| Cytogenetics | 8p12 |
| Refseq ORF | 1524 |
| Synonyms | C8orf41; MRT39 |
| Summary | This gene encodes a regulator of the DNA damage response. The protein is a component of the Triple T complex (TTT) which also includes telomere length regulation protein and TELO2 interacting protein 1. The TTT complex is involved in cellular resistance to DNA damage stresses and may act as a regulator of phosphoinositide-3-kinase-related protein kinase (PIKK) abundance. [provided by RefSeq, May 2013] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410894 | TTI2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420143 | TTI2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY410894 | Transient overexpression lysate of chromosome 8 open reading frame 41 (C8orf41), transcript variant 2 |
CNY 3080.00 |
|
| LY420143 | Transient overexpression lysate of chromosome 8 open reading frame 41 (C8orf41), transcript variant 1 |
CNY 4840.00 |
|
| PH309782 | C8orf41 MS Standard C13 and N15-labeled recombinant protein (NP_079391) |
CNY 19520.00 |
其它C8ORF41产品
