C8ORF41 (TTI2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TTI2 Antibody is: synthetic peptide directed towards the N-terminal region of Human TTI2. Synthetic peptide located within the following region: THSLEQPWTTPRSREVAREVLTSLLQVTECGSVAGFLHGENEDEKGRLSV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	56 kDa
Gene Name	TELO2 interacting protein 2
Database Link	NP_079391 Entrez Gene 80185 Human UniProt ID Q6NXR4
Background	TTI2 is a regulator of the DNA damage response (DDR). 'TTI2 is part of the TTT complex that is required to stabilize protein levels of the phosphatidylinositol 3-kinase-related protein kinase (PIKK) family proteins. The TTT complex is involved in the cellular resistance to DNA damage stresses, like ionizing radiation (IR), ultraviolet (UV) and mitomycin C (MMC). 'TTI2, together with the TTT complex and HSP90 may participate in the proper folding of newly synthesized PIKKs.
Synonyms	C8orf41; MRT39
Note	Immunogen sequence homology: Horse: 100%; Human: 100%; Bovine: 100%; Dog: 92%; Pig: 92%; Rabbit: 75%; Guinea pig: 75%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.