C8ORF41 (TTI2) Rabbit Polyclonal Antibody

CAT#: TA331723

Rabbit Polyclonal Anti-TTI2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
Transient overexpression lysate of chromosome 8 open reading frame 41 (C8orf41), transcript variant 2
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human chromosome 8 open reading frame 41 (C8orf41), transcript variant 2, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human chromosome 8 open reading frame 41 (C8orf41), transcript variant 2, 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-TTI2 Antibody is: synthetic peptide directed towards the N-terminal region of Human TTI2. Synthetic peptide located within the following region: THSLEQPWTTPRSREVAREVLTSLLQVTECGSVAGFLHGENEDEKGRLSV
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 56 kDa
Gene Name TELO2 interacting protein 2
Background TTI2 is a regulator of the DNA damage response (DDR). 'TTI2 is part of the TTT complex that is required to stabilize protein levels of the phosphatidylinositol 3-kinase-related protein kinase (PIKK) family proteins. The TTT complex is involved in the cellular resistance to DNA damage stresses, like ionizing radiation (IR), ultraviolet (UV) and mitomycin C (MMC). 'TTI2, together with the TTT complex and HSP90 may participate in the proper folding of newly synthesized PIKKs.
Synonyms C8orf41; MRT39
Note Immunogen sequence homology: Horse: 100%; Human: 100%; Bovine: 100%; Dog: 92%; Pig: 92%; Rabbit: 75%; Guinea pig: 75%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...