RD3 (NM_183059) Human Recombinant Protein
CAT#: TP309596
Recombinant protein of human retinal degeneration 3 (RD3), 20 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC209596 protein sequence
Red=Cloning site Green=Tags(s) MSLISWLRWNEAPSRLSTRSPAEMVLETLMMELTGQMREAERQQRERSNAVRKVCTGVDYSWLASTPRST YDLSPIERLQLEDVCVKIHPSYCGPAILRFRQLLAEQEPEVQEVSQLFRSVLQEVLERMKQEEEAHKLTR QWSLRPRGSLATFKTRARISPFASDIRTISEDVERDTPPPLRSWSMPEFRAPKAD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 22.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_898882 |
| Locus ID | 343035 |
| UniProt ID | Q7Z3Z2 |
| Refseq Size | 4290 |
| Cytogenetics | 1q32.3 |
| Refseq ORF | 585 |
| Synonyms | C1orf36; LCA12 |
| Summary | This gene encodes a retinal protein that is associated with promyelocytic leukemia-gene product (PML) bodies in the nucleus. Mutations in this gene cause Leber congenital amaurosis type 12, a disease that results in retinal degeneration. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405222 | RD3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431781 | RD3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405222 | Transient overexpression lysate of retinal degeneration 3 (RD3), transcript variant 1 |
CNY 3080.00 |
|
| LY431781 | Transient overexpression lysate of retinal degeneration 3 (RD3), transcript variant 2 |
CNY 3080.00 |
|
| PH309596 | RD3 MS Standard C13 and N15-labeled recombinant protein (NP_898882) |
CNY 19520.00 |
