RD3 (NM_183059) Human Mass Spec Standard
CAT#: PH309596
RD3 MS Standard C13 and N15-labeled recombinant protein (NP_898882)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | RD3 MS Standard C13 and N15-labeled recombinant protein (NP_898882) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209596 |
| Predicted MW | 22.7 kDa |
| Protein Sequence |
>RC209596 protein sequence
Red=Cloning site Green=Tags(s) MSLISWLRWNEAPSRLSTRSPAEMVLETLMMELTGQMREAERQQRERSNAVRKVCTGVDYSWLASTPRST YDLSPIERLQLEDVCVKIHPSYCGPAILRFRQLLAEQEPEVQEVSQLFRSVLQEVLERMKQEEEAHKLTR QWSLRPRGSLATFKTRARISPFASDIRTISEDVERDTPPPLRSWSMPEFRAPKAD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_898882 |
| RefSeq Size | 4290 |
| RefSeq ORF | 585 |
| Synonyms | C1orf36; LCA12 |
| Locus ID | 343035 |
| Cytogenetics | 1q32.3 |
| Summary | This gene encodes a retinal protein that is associated with promyelocytic leukemia-gene product (PML) bodies in the nucleus. Mutations in this gene cause Leber congenital amaurosis type 12, a disease that results in retinal degeneration. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405222 | RD3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431781 | RD3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405222 | Transient overexpression lysate of retinal degeneration 3 (RD3), transcript variant 1 |
CNY 3080.00 |
|
| LY431781 | Transient overexpression lysate of retinal degeneration 3 (RD3), transcript variant 2 |
CNY 3080.00 |
|
| TP309596 | Recombinant protein of human retinal degeneration 3 (RD3), 20 µg |
CNY 2900.00 |
