CENPL (NM_033319) Human Recombinant Protein
CAT#: TP309587
Recombinant protein of human centromere protein L (CENPL), transcript variant 2, 20 µg
View other "CENPL" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209587 protein sequence
Red=Cloning site Green=Tags(s) MDSYSAPESTPSASSRPEDYFIGATPLQKRLESVRKQSSFILTPPRRKIPQCSQLQEDVDPQKVAFLLHK QWTLYSLTPLYKFSYSNLKEYSRLLNAFIVAEKQKGLAVEVGEDFNIKVIFSTLLGMKGTQRDPEAFLVQ IVSKSQLPSENREGKVLWTGWFCCVFGDSLLETVSEDFTCLPLFLANGAESNTAIIGTWFQKTFDCYFSP LAINAFNLSWMAAMWTACKMDHYVATTEFLWSVPCSPQSLDISFAIHPEDAKALWDSVHKTPGEVTQEEV DLFMDCLYSHFHRHFKIHLSATRLVRVSTSVASAHTDGKIKILCHKYLIGVLAYLTELAIFQIE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 38.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_201576 |
Locus ID | 91687 |
UniProt ID | Q8N0S6 |
Refseq Size | 2555 |
Cytogenetics | 1q25.1 |
Refseq ORF | 1032 |
Synonyms | C1orf155; CENP-L; dJ383J4.3 |
Summary | CENPL is a subunit of a CENPH (MIM 605607)-CENPI (MIM 300065)-associated centromeric complex that targets CENPA (MIM 117139) to centromeres and is required for proper kinetochore function and mitotic progression (Okada et al., 2006) [PubMed 16622420].[supplied by OMIM, Mar 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409603 | CENPL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432913 | CENPL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409603 | Transient overexpression lysate of centromere protein L (CENPL), transcript variant 2 |
CNY 3080.00 |
|
LY432913 | Transient overexpression lysate of centromere protein L (CENPL), transcript variant 3 |
CNY 3080.00 |
|
PH309587 | CENPL MS Standard C13 and N15-labeled recombinant protein (NP_201576) |
CNY 19520.00 |