CENPL Rabbit Polyclonal Antibody
CAT#: TA335421
Rabbit Polyclonal Anti-CENPL Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-CENPL Antibody is: synthetic peptide directed towards the middle region of Human CENPL. Synthetic peptide located within the following region: FSTLLGMKGTQRDPEAFLVQIVSKSQLPSENREGKVLWTGWFCCVFGDSL |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 38 kDa |
Gene Name | centromere protein L |
Database Link | |
Background | CENPL is a subunit of a CENPH -CENPI-associated centromeric complex that targets CENPA to centromeres and is required for proper kinetochore function and mitotic progression. |
Synonyms | C1orf155; CENP-L; dJ383J4.3 |
Note | Immunogen Sequence Homology: Horse: 100%; Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Bovine: 86%; Guinea pig: 86%; Rabbit: 77% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |