THOC7 (NM_025075) Human Recombinant Protein
CAT#: TP309500
Recombinant protein of human THO complex 7 homolog (Drosophila) (THOC7), 20 µg
View other "THOC7" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209500 protein sequence
Red=Cloning site Green=Tags(s) MGAVTDDEVIRKRLLIDGDGAGDDRRINLLVKSFIKWCNSGSQEEGYSQYQRMLSTLSQCEFSMGKTLLV YDMNLREMENYEKIYKEIECSIAGAHEKIAECKKQILQAKRIRKNRQEYDALAKVIQHHPDRHETLKELE ALGKELEHLSHIKESVEDKLELRRKQFHVLLSTIHELQQTLENDEKLSEVEEAQEASMETDPKP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079351 |
Locus ID | 80145 |
UniProt ID | Q6I9Y2 |
Refseq Size | 1027 |
Cytogenetics | 3p14.1 |
Refseq ORF | 612 |
Synonyms | fSAP24; hTREX30; NIF3L1BP1 |
Summary | Required for efficient export of polyadenylated RNA. Acts as component of the THO subcomplex of the TREX complex which is thought to couple mRNA transcription, processing and nuclear export, and which specifically associates with spliced mRNA and not with unspliced pre-mRNA. TREX is recruited to spliced mRNAs by a transcription-independent mechanism, binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export to the cytoplasm via the TAP/NFX1 pathway.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410901 | THOC7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410901 | Transient overexpression lysate of THO complex 7 homolog (Drosophila) (THOC7) |
CNY 3080.00 |
|
PH309500 | THOC7 MS Standard C13 and N15-labeled recombinant protein (NP_079351) |
CNY 19520.00 |