THOC7 (NM_025075) Human Mass Spec Standard
CAT#: PH309500
THOC7 MS Standard C13 and N15-labeled recombinant protein (NP_079351)
View other "THOC7" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | THOC7 MS Standard C13 and N15-labeled recombinant protein (NP_079351) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209500 |
Predicted MW | 23.7 kDa |
Protein Sequence |
>RC209500 protein sequence
Red=Cloning site Green=Tags(s) MGAVTDDEVIRKRLLIDGDGAGDDRRINLLVKSFIKWCNSGSQEEGYSQYQRMLSTLSQCEFSMGKTLLV YDMNLREMENYEKIYKEIECSIAGAHEKIAECKKQILQAKRIRKNRQEYDALAKVIQHHPDRHETLKELE ALGKELEHLSHIKESVEDKLELRRKQFHVLLSTIHELQQTLENDEKLSEVEEAQEASMETDPKP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_079351 |
RefSeq Size | 1027 |
RefSeq ORF | 612 |
Synonyms | fSAP24; hTREX30; NIF3L1BP1 |
Locus ID | 80145 |
Cytogenetics | 3p14.1 |
Summary | Required for efficient export of polyadenylated RNA. Acts as component of the THO subcomplex of the TREX complex which is thought to couple mRNA transcription, processing and nuclear export, and which specifically associates with spliced mRNA and not with unspliced pre-mRNA. TREX is recruited to spliced mRNAs by a transcription-independent mechanism, binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export to the cytoplasm via the TAP/NFX1 pathway.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410901 | THOC7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410901 | Transient overexpression lysate of THO complex 7 homolog (Drosophila) (THOC7) |
CNY 3080.00 |
|
TP309500 | Recombinant protein of human THO complex 7 homolog (Drosophila) (THOC7), 20 µg |
CNY 2900.00 |