NSMCE4A (NM_017615) Human Recombinant Protein
CAT#: TP309357
Recombinant protein of human non-SMC element 4 homolog A (S. cerevisiae) (NSMCE4A), 20 µg
View other "NSMCE4A" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC209357 protein sequence
Red=Cloning site Green=Tags(s) MSGDSSGRGGRGRGRDHRDRTRSRSRSRSSRSRRGSARRRARSDTSDSGDMMDASAADGCRRHYRANSVN RDNAGDKTVANTNVSRARAVDAHVASDGKKAKRSDSSDMRYVTTHMGVNARDDSDVYDSWKTGRTANTNK THTHGSYGCVKRVDRRKVVRAMARRMSHATKVRGTYRDDTMSDVVDHSRTVNHVSRDGARRDDRVVSNNG HNTVRNGASYRDWVKTSVTSRKSA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 44.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_060085 |
| Locus ID | 54780 |
| UniProt ID | Q9NXX6 |
| Refseq Size | 1420 |
| Cytogenetics | 10q26.13 |
| Refseq ORF | 1158 |
| Synonyms | C10orf86; NS4EA; NSE4A |
| Summary | Component of the SMC5-SMC6 complex, a complex involved in DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks. The complex is required for telomere maintenance via recombination in ALT (alternative lengthening of telomeres) cell lines and mediates sumoylation of shelterin complex (telosome) components which is proposed to lead to shelterin complex disassembly in ALT-associated PML bodies (APBs). Is involved in positive regulation of response to DNA damage stimulus.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413676 | NSMCE4A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413676 | Transient overexpression lysate of non-SMC element 4 homolog A (S. cerevisiae) (NSMCE4A), transcript variant 1 |
CNY 3080.00 |
|
| PH309357 | NSMCE4A MS Standard C13 and N15-labeled recombinant protein (NP_060085) |
CNY 19520.00 |
其它NSMCE4A产品
