NSMCE4A (NM_017615) Human Mass Spec Standard
CAT#: PH309357
NSMCE4A MS Standard C13 and N15-labeled recombinant protein (NP_060085)
View other "NSMCE4A" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | NSMCE4A MS Standard C13 and N15-labeled recombinant protein (NP_060085) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209357 |
| Predicted MW | 44.2 kDa |
| Protein Sequence |
>RC209357 protein sequence
Red=Cloning site Green=Tags(s) MSGDSSGRGGRGRGRDHRDRTRSRSRSRSSRSRRGSARRRARSDTSDSGDMMDASAADGCRRHYRANSVN RDNAGDKTVANTNVSRARAVDAHVASDGKKAKRSDSSDMRYVTTHMGVNARDDSDVYDSWKTGRTANTNK THTHGSYGCVKRVDRRKVVRAMARRMSHATKVRGTYRDDTMSDVVDHSRTVNHVSRDGARRDDRVVSNNG HNTVRNGASYRDWVKTSVTSRKSA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_060085 |
| RefSeq Size | 1420 |
| RefSeq ORF | 1158 |
| Synonyms | C10orf86; NS4EA; NSE4A |
| Locus ID | 54780 |
| Cytogenetics | 10q26.13 |
| Summary | Component of the SMC5-SMC6 complex, a complex involved in DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks. The complex is required for telomere maintenance via recombination in ALT (alternative lengthening of telomeres) cell lines and mediates sumoylation of shelterin complex (telosome) components which is proposed to lead to shelterin complex disassembly in ALT-associated PML bodies (APBs). Is involved in positive regulation of response to DNA damage stimulus.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413676 | NSMCE4A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413676 | Transient overexpression lysate of non-SMC element 4 homolog A (S. cerevisiae) (NSMCE4A), transcript variant 1 |
CNY 3080.00 |
|
| TP309357 | Recombinant protein of human non-SMC element 4 homolog A (S. cerevisiae) (NSMCE4A), 20 µg |
CNY 2900.00 |
其它NSMCE4A产品
