SCOC (NM_032547) Human Recombinant Protein
CAT#: TP309356
Recombinant protein of human short coiled-coil protein (SCOC), 20 µg
View other "SCOC" proteins (6)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC209356 protein sequence
Red=Cloning site Green=Tags(s) MDGSRKEEEEDSTFTNISLADDIDHSSRILYPRPKSLLPKMMNADMDVDAENQVELEEKTRLINQVLELQ HTLEDLSARVDAVKEENLKLKSENQVLGQYIENLMSASSVFQTTDTKSKRK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 13.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_115936 |
| Locus ID | 60592 |
| UniProt ID | Q9UIL1 |
| Refseq Size | 1974 |
| Cytogenetics | 4q31.1 |
| Refseq ORF | 363 |
| Synonyms | HRIHFB2072; SCOCO; UNC-69 |
| Summary | This gene encodes a short coiled-coiled domain-containing protein that localizes to the Golgi apparatus. The encoded protein interacts with ADP-ribosylation factor-like proteins. Pseudogenes of this gene are found on chromosomes 1 and 14. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410036 | SCOC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431758 | SCOC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410036 | Transient overexpression lysate of short coiled-coil protein (SCOC), transcript variant 4 |
CNY 3080.00 |
|
| LY431758 | Transient overexpression lysate of short coiled-coil protein (SCOC), transcript variant 6 |
CNY 3080.00 |
|
| PH309356 | SCOC MS Standard C13 and N15-labeled recombinant protein (NP_115936) |
CNY 19520.00 |
|
| TP328730 | Recombinant protein of human short coiled-coil protein (SCOC), transcript variant 6, 20 µg |
CNY 2900.00 |
