SCOC (NM_032547) Human Mass Spec Standard
CAT#: PH309356
SCOC MS Standard C13 and N15-labeled recombinant protein (NP_115936)
View other "SCOC" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | SCOC MS Standard C13 and N15-labeled recombinant protein (NP_115936) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209356 |
| Predicted MW | 13.9 kDa |
| Protein Sequence |
>RC209356 protein sequence
Red=Cloning site Green=Tags(s) MDGSRKEEEEDSTFTNISLADDIDHSSRILYPRPKSLLPKMMNADMDVDAENQVELEEKTRLINQVLELQ HTLEDLSARVDAVKEENLKLKSENQVLGQYIENLMSASSVFQTTDTKSKRK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_115936 |
| RefSeq Size | 1974 |
| RefSeq ORF | 363 |
| Synonyms | HRIHFB2072; SCOCO; UNC-69 |
| Locus ID | 60592 |
| Cytogenetics | 4q31.1 |
| Summary | This gene encodes a short coiled-coiled domain-containing protein that localizes to the Golgi apparatus. The encoded protein interacts with ADP-ribosylation factor-like proteins. Pseudogenes of this gene are found on chromosomes 1 and 14. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410036 | SCOC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431758 | SCOC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410036 | Transient overexpression lysate of short coiled-coil protein (SCOC), transcript variant 4 |
CNY 3080.00 |
|
| LY431758 | Transient overexpression lysate of short coiled-coil protein (SCOC), transcript variant 6 |
CNY 3080.00 |
|
| TP309356 | Recombinant protein of human short coiled-coil protein (SCOC), 20 µg |
CNY 2900.00 |
|
| TP328730 | Recombinant protein of human short coiled-coil protein (SCOC), transcript variant 6, 20 µg |
CNY 2900.00 |
