ASCL2 (NM_005170) Human Recombinant Protein
CAT#: TP309250
Recombinant protein of human achaete-scute complex homolog 2 (Drosophila) (ASCL2), 20 µg
View other "ASCL2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209250 protein sequence
Red=Cloning site Green=Tags(s) MDGGTLPRSAPPAPPVPVGCAARRRPASPELLRCSRRRRPATAETGGGAAAVARRNERERNRVKLVNLGF QALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGLRPQAVRPSAPRGPPGTTPVA ASPSRASSSPGRGGSSEPGSPRSAYSSDDSGCEGALSPAERELLDFSSWLGGY SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 20 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005161 |
Locus ID | 430 |
UniProt ID | Q99929 |
Refseq Size | 1864 |
Cytogenetics | 11p15.5 |
Refseq ORF | 579 |
Synonyms | ASH2; bHLHa45; HASH2; MASH2 |
Summary | This gene is a member of the basic helix-loop-helix (BHLH) family of transcription factors. It activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. Involved in the determination of the neuronal precursors in the peripheral nervous system and the central nervous system. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417473 | ASCL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417473 | Transient overexpression lysate of achaete-scute complex homolog 2 (Drosophila) (ASCL2) |
CNY 3080.00 |
|
PH309250 | ASCL2 MS Standard C13 and N15-labeled recombinant protein (NP_005161) |
CNY 14250.00 |