ASCL2 (NM_005170) Human Mass Spec Standard
CAT#: PH309250
ASCL2 MS Standard C13 and N15-labeled recombinant protein (NP_005161)
View other "ASCL2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | ASCL2 MS Standard C13 and N15-labeled recombinant protein (NP_005161) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209250 |
| Predicted MW | 20.2 kDa |
| Protein Sequence |
>RC209250 protein sequence
Red=Cloning site Green=Tags(s) MDGGTLPRSAPPAPPVPVGCAARRRPASPELLRCSRRRRPATAETGGGAAAVARRNERERNRVKLVNLGF QALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGLRPQAVRPSAPRGPPGTTPVA ASPSRASSSPGRGGSSEPGSPRSAYSSDDSGCEGALSPAERELLDFSSWLGGY SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005161 |
| RefSeq Size | 1864 |
| RefSeq ORF | 579 |
| Synonyms | ASH2; bHLHa45; HASH2; MASH2 |
| Locus ID | 430 |
| Cytogenetics | 11p15.5 |
| Summary | This gene is a member of the basic helix-loop-helix (BHLH) family of transcription factors. It activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. Involved in the determination of the neuronal precursors in the peripheral nervous system and the central nervous system. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417473 | ASCL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417473 | Transient overexpression lysate of achaete-scute complex homolog 2 (Drosophila) (ASCL2) |
CNY 3080.00 |
|
| TP309250 | Recombinant protein of human achaete-scute complex homolog 2 (Drosophila) (ASCL2), 20 µg |
CNY 2900.00 |
