C7orf59 (LAMTOR4) (NM_001008395) Human Recombinant Protein
CAT#: TP309099
Recombinant protein of human chromosome 7 open reading frame 59 (C7orf59), 20 µg
View other "C7orf59" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209099 protein sequence
Red=Cloning site Green=Tags(s) MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMNVPFKRLSVVF GEHTLLVTVSGQRVFVVKRQNRGREPIDV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 10.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001008396 |
Locus ID | 389541 |
UniProt ID | Q0VGL1 |
Refseq Size | 613 |
Cytogenetics | 7q22.1 |
Refseq ORF | 297 |
Synonyms | C7orf59 |
Summary | As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC423422 | LAMTOR4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY423422 | Transient overexpression lysate of chromosome 7 open reading frame 59 (C7orf59) |
CNY 3080.00 |
|
PH309099 | C7orf59 MS Standard C13 and N15-labeled recombinant protein (NP_001008396) |
CNY 19520.00 |
其它C7orf59产品