C7orf59 (LAMTOR4) (NM_001008395) Human Mass Spec Standard
CAT#: PH309099
C7orf59 MS Standard C13 and N15-labeled recombinant protein (NP_001008396)
View other "C7orf59" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
Product Data | |
Description | C7orf59 MS Standard C13 and N15-labeled recombinant protein (NP_001008396) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209099 |
Predicted MW | 10.7 kDa |
Protein Sequence |
>RC209099 protein sequence
Red=Cloning site Green=Tags(s) MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMNVPFKRLSVVF GEHTLLVTVSGQRVFVVKRQNRGREPIDV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001008396 |
RefSeq Size | 613 |
RefSeq ORF | 297 |
Synonyms | C7orf59 |
Locus ID | 389541 |
Cytogenetics | 7q22.1 |
Summary | As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC423422 | LAMTOR4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY423422 | Transient overexpression lysate of chromosome 7 open reading frame 59 (C7orf59) |
CNY 3080.00 |
|
TP309099 | Recombinant protein of human chromosome 7 open reading frame 59 (C7orf59), 20 µg |
CNY 2900.00 |
其它C7orf59产品