RED1 (ADARB1) (NM_001112) Human Recombinant Protein
CAT#: TP309073
Recombinant protein of human adenosine deaminase, RNA-specific, B1 (RED1 homolog rat) (ADARB1), transcript variant 1, 20 µg
View other "RED1" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC209073 representing NM_001112
Red=Cloning site Green=Tags(s) MDIEDEENMSSSSTDVKENRNLDNVSPKDGSTPGPGEGSQLSNGGGGGPGRKRPLEEGSNGHSKYRLKKR RKTPGPVLPKNALMQLNEIKPGLQYTLLSQTGPVHAPLFVMSVEVNGQVFEGSGPTKKKAKLHAAEKALR SFVQFPNASEAHLAMGRTLSVNTDFTSDQADFPDTLFNGFETPDKAEPPFYVGSNGDDSFSSSGDLSLSA SPVPASLAQPPLPALPPFPPPSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRN KKLAKARAAQSALAAIFNLHLDQTPSRQPIPSEGLQLHLPQVLADAVSRLVLGKFGDLTDNFSSPHARRK VLAGVVMTTGTDVKDAKVISVSTGTKCINGEYMSDRGLALNDCHAEIISRRSLLRFLYTQLELYLNNKDD QKRSIFQKSERGGFRLKENVQFHLYISTSPCGDARIFSPHEPILEEPADRHPNRKARGQLRTKIESGEGT IPVRSNASIQTWDGVLQGERLLTMSCSDKIARWNVVGIQGSLLSIFVEPIYFSSIILGSLYHGDHLSRAM YQRISNIEDLPPLYTLNKPLLSGISNAEARQPGKAPNFSVNWTVGDSAIEVINATTGKDELGRASRLCKH ALYCRWMRVHGKVPSHLLRSKITKPNVYHESKLAAKEYQAAKARLFTAFIKAGLGAWVEKPTEQDQFSLT P SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Predicted MW | 76.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001103 |
| Locus ID | 104 |
| UniProt ID | P78563 |
| Refseq Size | 6881 |
| Cytogenetics | 21q22.3 |
| Refseq ORF | 2103 |
| Synonyms | ADAR2; DRABA2; DRADA2; NEDHYMS; RED1 |
| Summary | This gene encodes the enzyme responsible for pre-mRNA editing of the glutamate receptor subunit B by site-specific deamination of adenosines. Studies in rat found that this enzyme acted on its own pre-mRNA molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site. Alternative splicing of this gene results in several transcript variants, some of which have been characterized by the presence or absence of an ALU cassette insert and a short or long C-terminal region. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414364 | ADARB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC420129 | ADARB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431557 | ADARB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY414364 | Transient overexpression lysate of adenosine deaminase, RNA-specific, B1 (RED1 homolog rat) (ADARB1), transcript variant 2 |
CNY 4840.00 |
|
| LY420129 | Transient overexpression lysate of adenosine deaminase, RNA-specific, B1 (RED1 homolog rat) (ADARB1), transcript variant 1 |
CNY 3080.00 |
|
| LY431557 | Transient overexpression lysate of adenosine deaminase, RNA-specific, B1 (ADARB1), transcript variant 7 |
CNY 4840.00 |
|
| PH309073 | ADARB1 MS Standard C13 and N15-labeled recombinant protein (NP_001103) |
CNY 19520.00 |
|
| PH312324 | ADARB1 MS Standard C13 and N15-labeled recombinant protein (NP_056648) |
CNY 14250.00 |
|
| TP312324 | Purified recombinant protein of Homo sapiens adenosine deaminase, RNA-specific, B1 (RED1 homolog rat) (ADARB1), transcript variant 2, 20 µg |
CNY 2900.00 |
