RED1 (ADARB1) (NM_001112) Human Mass Spec Standard
CAT#: PH309073
ADARB1 MS Standard C13 and N15-labeled recombinant protein (NP_001103)
View other "RED1" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | ADARB1 MS Standard C13 and N15-labeled recombinant protein (NP_001103) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209073 |
| Predicted MW | 76.5 kDa |
| Protein Sequence |
>RC209073 representing NM_001112
Red=Cloning site Green=Tags(s) MDIEDEENMSSSSTDVKENRNLDNVSPKDGSTPGPGEGSQLSNGGGGGPGRKRPLEEGSNGHSKYRLKKR RKTPGPVLPKNALMQLNEIKPGLQYTLLSQTGPVHAPLFVMSVEVNGQVFEGSGPTKKKAKLHAAEKALR SFVQFPNASEAHLAMGRTLSVNTDFTSDQADFPDTLFNGFETPDKAEPPFYVGSNGDDSFSSSGDLSLSA SPVPASLAQPPLPALPPFPPPSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRN KKLAKARAAQSALAAIFNLHLDQTPSRQPIPSEGLQLHLPQVLADAVSRLVLGKFGDLTDNFSSPHARRK VLAGVVMTTGTDVKDAKVISVSTGTKCINGEYMSDRGLALNDCHAEIISRRSLLRFLYTQLELYLNNKDD QKRSIFQKSERGGFRLKENVQFHLYISTSPCGDARIFSPHEPILEEPADRHPNRKARGQLRTKIESGEGT IPVRSNASIQTWDGVLQGERLLTMSCSDKIARWNVVGIQGSLLSIFVEPIYFSSIILGSLYHGDHLSRAM YQRISNIEDLPPLYTLNKPLLSGISNAEARQPGKAPNFSVNWTVGDSAIEVINATTGKDELGRASRLCKH ALYCRWMRVHGKVPSHLLRSKITKPNVYHESKLAAKEYQAAKARLFTAFIKAGLGAWVEKPTEQDQFSLT P SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001103 |
| RefSeq Size | 6881 |
| RefSeq ORF | 2103 |
| Synonyms | ADAR2; DRABA2; DRADA2; NEDHYMS; RED1 |
| Locus ID | 104 |
| Cytogenetics | 21q22.3 |
| Summary | This gene encodes the enzyme responsible for pre-mRNA editing of the glutamate receptor subunit B by site-specific deamination of adenosines. Studies in rat found that this enzyme acted on its own pre-mRNA molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site. Alternative splicing of this gene results in several transcript variants, some of which have been characterized by the presence or absence of an ALU cassette insert and a short or long C-terminal region. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414364 | ADARB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC420129 | ADARB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431557 | ADARB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY414364 | Transient overexpression lysate of adenosine deaminase, RNA-specific, B1 (RED1 homolog rat) (ADARB1), transcript variant 2 |
CNY 4840.00 |
|
| LY420129 | Transient overexpression lysate of adenosine deaminase, RNA-specific, B1 (RED1 homolog rat) (ADARB1), transcript variant 1 |
CNY 3080.00 |
|
| LY431557 | Transient overexpression lysate of adenosine deaminase, RNA-specific, B1 (ADARB1), transcript variant 7 |
CNY 4840.00 |
|
| PH312324 | ADARB1 MS Standard C13 and N15-labeled recombinant protein (NP_056648) |
CNY 14250.00 |
|
| TP309073 | Recombinant protein of human adenosine deaminase, RNA-specific, B1 (RED1 homolog rat) (ADARB1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP312324 | Purified recombinant protein of Homo sapiens adenosine deaminase, RNA-specific, B1 (RED1 homolog rat) (ADARB1), transcript variant 2, 20 µg |
CNY 2900.00 |
